TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01545 XX ID T01545 XX DT 07.08.1995 (created); ewi. DT 03.09.2013 (updated); uat. CO Copyright (C), QIAGEN. XX FA E2F-3a XX SY E2F transcription factor 3; E2F-3; E2F3; E2F3a; KIAA0075. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002036 E2F3; HGNC: E2F3. XX CL C0023; fork head. XX SZ 465 AA; 49.2 kDa (cDNA) (calc.). XX SQ MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQI SQ LTTNTSTTSCSSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALG SQ RGGSGGGGGPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYD SQ TSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQ SQ WMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVT SQ YQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSP SQ MKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEG SQ PFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS XX SC Swiss-Prot#O00716-1 XX FT 20 327 PF00478; IMP dehydrogenase / GMP reductase domain. FT 178 243 PF02319; E2F/DP family winged-helix DNA-binding domai. FT 295 357 marked box domain, interaction with TFE3 [4]. XX SF clear binding preference to Rb over p107; XX FF transcriptional activator, synergistically acting through multiple E2F sites; FF expression in T-cells depends on cell cycle reentry and peaks at G1/S phase transition and during S phase, where E2F-3 is associated with pRb [2]; FF directly interacts and synergistically activates transcription with TFE3, in contrast to other members of E2F family [4]; XX IN T16158 RING1B; human, Homo sapiens. IN T00811 TFEA; human, Homo sapiens. XX MX M00940 V$E2F1_Q6_01. MX M02089 V$E2F3_Q6. MX M00050 V$E2F_02. MX M00803 V$E2F_Q2. MX M00918 V$E2F_Q3_01. MX M00919 V$E2F_Q4_01. MX M00939 V$E2F_Q4_02. MX M08875 V$E2F_Q4_03. MX M00920 V$E2F_Q6_01. XX BS R04555. BS R09600. BS R25908. BS R09599. BS R09542. BS R09543. XX DR TRANSPATH: MO000004279. DR TRANSCOMPEL: C00427. DR EMBL: D38550; DR EMBL: Y10479; DR UniProtKB: O00716-1; XX RN [1]; RE0003316. RX PUBMED: 8246996. RA Lees J. A., Saito M., Vidal M., Valentine M., Look T., Harlow E., Dyson N., Helin K. RT The retinoblastoma protein binds to a family of E2F transcription factors RL Mol. Cell. Biol. 13:7813-7825 (1993). RN [2]; RE0012605. RX PUBMED: 8657117. RA Moberg K., Starz M. A., Lees J. A. RT E2F-4 switches from p130 to p107 and pRB in response to cell cycle reentry RL Mol. Cell. Biol. 16:1436-1449 (1996). RN [3]; RE0015322. RX PUBMED: 10090723. RA Zheng N., Fraenkel E., Pabo C. O., Pavletich N. P. RT Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP RL Genes Dev. 13:666-674 (1999). RN [4]; RE0025050. RX PUBMED: 12748276. RA Giangrande P. H., Hallstrom T. C., Tunyaplin C., Calame K., Nevins J. R. RT Identification of E-box factor TFE3 as a functional partner for the E2F3 transcription factor. RL Mol. Cell. Biol. 23:3707-3720 (2003). RN [5]; RE0031299. RX PUBMED: 12411495. RA Schlisio S., Halperin T., Vidal M., Nevins J. R. RT Interaction of YY1 with E2Fs, mediated by RYBP, provides a mechanism for specificity of E2F function. RL EMBO J. 21:5775-86 (2002). RN [6]; RE0048944. RX PUBMED: 16481464. RA Hallstrom T. C., Nevins J. R. RT Jab1 is a specificity factor for E2F1-induced apoptosis. RL Genes Dev. 20:613-623 (2006). RN [7]; RE0070084. RX PUBMED: 19917728. RA Martinez L. A., Goluszko E., Chen H. Z., Leone G., Post S., Lozano G., Chen Z., Chauchereau A. RT E2F3 is a mediator of DNA damage-induced apoptosis. RL Mol. Cell. Biol. 30:524-536 (2010). XX //