TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01649 XX ID T01649 XX DT 01.02.1996 (created); ewi. DT 26.03.2008 (updated); dbh. CO Copyright (C), QIAGEN. XX FA HES-1 XX SY hairy and enhancer of split 1 (Drosophila); HRY. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G001025 Hes1. XX HO Hairy, E(spl) proteins. XX CL C0010; bHLH. XX SZ 282 AA; 29.7 kDa (cDNA) (calc.). XX SQ MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL SQ ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE SQ VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAHPALQAPPPPPPSGPAGPQHA SQ PFAPPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAF SQ AHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTSDSMWRPWRN XX SC Swiss-Prot#P35428 XX FT 34 92 PS50888; HLH. FT 35 92 PF00010; Helix-loop-helix DNA-binding domain. FT 40 97 SM00353; finulus. FT 108 152 PF07527; Hairy Orange. FT 108 152 SM00511; ORANGE. FT 110 143 PS51054; ORANGE. XX FF negative autoregulation through N-box elements [1]; FF inhibits neural differentiation in CNS [2]; FF hypoplasia of the pancreas in Hes1-/- mutants due to increased endocrine differentiation [3]; FF in absence of Hes-1 accelerated and excessive formation of endocrine cell types in stomach and gut [3]; FF the gut of Hes1-/- mutants shows increased expression of Nkx2-2, Isl1, Pax4, Pax6, and the Notch ligands encoding genes Dll1 and Dll3 [3]; FF able to down-regulate CD4 in T-cells [4]; FF overexpression of HES-1 blocks differentiation of pre-adipocytes [5]; FF downregulated by treatment with FGSIs (functional gamma-secretase inhibitors), probably through disruption of Notch processing [5]; XX IN T00138 c-Myb; mouse, Mus musculus. XX MX M01009 V$HES1_Q2. MX M07042 V$HES1_Q3. MX M07420 V$HES1_Q4. MX M02011 V$HES1_Q6. XX BS R16668. BS R15379. BS R23731. BS R15364. BS R15366. BS R15367. BS R15377. BS R22829. BS R02601. BS R04468. BS R04469. BS R04470. XX DR TRANSPATH: MO000025836. DR EMBL: D16464; DR UniProtKB: P35428; XX RN [1]; RE0003679. RX PUBMED: 7906273. RA Takebayashi K., Sasai Y., Sakai Y., Watanabe T., Nakanishi S., Kageyama R. RT Structure, chromosomal locus, and promoter analysis of the gene encoding the mouse helix-loop-helix factor HES-1 RL J. Biol. Chem. 269:5150-5156 (1994). RN [2]; RE0003683. RX PUBMED: 7909512. RA Ishibashi M., Moriyoshi K., Sasai Y., Shiota K., Nakanishi S., Kageyama R. RT Persistent expression of helix-loop-helix factor HES-1 prevents mammalian neural differentiation in the central nervous system RL EMBO J. 13:1799-1805 (1994). RN [3]; RE0024539. RX PUBMED: 10615124. RA Jensen J., Pedersen E. E., Galante P., Hald J., Heller R. S., Ishibashi M., Kageyama R., Guillemot F., Serup P., Madsen O. D. RT Control of endodermal endocrine development by Hes-1. RL Nat. Genet. 24:36-44 (2000). RN [4]; RE0024578. RX PUBMED: 9819403. RA Kim H. K., Siu G. RT The notch pathway intermediate HES-1 silences CD4 gene expression. RL Mol. Cell. Biol. 18:7166-7175 (1998). RN [5]; RE0024600. RX PUBMED: 12949072. RA Searfoss G. H., Jordan W. H., Calligaro D. O., Galbreath E. J., Schirtzinger L. M., Berridge B. R., Gao H., Higgins M. A., May P. C., Ryan T. P. RT Adipsin, a biomarker of gastrointestinal toxicity mediated by a functional gamma-secretase inhibitor. RL J. Biol. Chem. 278:46107-46116 (2003). XX //