TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01909 XX ID T01909 XX DT 15.08.1996 (created); ewi. DT 15.03.2012 (updated); sla. CO Copyright (C), QIAGEN. XX FA NF-1B2 XX SY 6720429L07Rik; CCAAT-box-binding transcription factor; CTF; mNFI-B2; NFI-B2; NFIB; nuclear factor I/B. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G005252 Nfib. XX CL C0060; NF1. XX SZ 487 AA; 54.8 kDa (cDNA) (calc.). XX SQ MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDE SQ LLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDC SQ LRQADKVWRLGLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFL SQ AYYVQEQDSGQSGSPSHSDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFP SQ IGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPNSPAAGS SQ RTWHERDQDMSSPTTMKKPEKPLFSSTSPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTP SQ PPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQLRICD SQ WTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVSNRTPILPANVQNYGLNIIGEPF SQ LQAETSN XX SC translated from EMBL #Y07687 XX FT 2 195 PS51080; CTF_NFI_2. FT 66 173 PF03165; MH1 domain. FT 68 176 SM00523; dwAneu5. FT 209 474 PF00859; CTF/NF-I family transcription modulation reg. XX SF exons 9 and 10 missing, EMBL:Y07687; SF at least five splice variants: NF-1B1, -B2, -B3, -B4, and -B5 [3] [1]; SF by sequence similarity, they are homologous to the chicken NF-1A proteins [2]; XX IN T00545 POU2F1; human, Homo sapiens. IN T10209 TTF-1; rat, Rattus norvegicus. XX MX M00056 V$MYOGNF1_01. MX M07051 V$NF1B_Q6. MX M07363 V$NF1FAMILY_Q4. MX M07364 V$NF1_Q6_02. XX BS R32258. XX DR TRANSPATH: MO000026026. DR EMBL: D90173; DR EMBL: Y07687; DR UniProtKB: P97863-2; XX RN [1]; RE0000956. RX PUBMED: 1699939. RA Inoue T., Tamura T.-A., Furuichi T., Mikoshiba K. RT Isolation of complementary DNAs encoding a cerebellum-enriched nuclear factor I family that activates transcription from the mouse myelin basic protein promoter RL J. Biol. Chem. 265:19065-19070 (1990). RN [2]; RE0004448. RX PUBMED: 8182757. RA Kruse U., Sippel A. E. RT The genes for transcription factor nuclear factor I give rise to corresponding splice variants between vertebrate species RL J. Mol. Biol. 238:860-865 (1994). RN [3]; RE0025475. RX PUBMED: 12568726. RA Grunder A., Qian F., Ebel T. T., Mincheva A., Lichter P., Kruse U., Sippel A. E. RT Genomic organization, splice products and mouse chromosomal localization of genes for transcription factor Nuclear Factor One. RL Gene 304:171-181 (2003). RN [4]; RE0030635. RX PUBMED: 14645514. RA Bachurski C. J., Yang G. H., Currier T. A., Gronostajski R. M., Hong D. RT Nuclear factor I/thyroid transcription factor 1 interactions modulate surfactant protein C transcription. RL Mol. Cell. Biol. 23:9014-24 (2003). RN [5]; RE0047957. RX PUBMED: 15319450. RA Givens M. L., Kurotani R., Rave-Harel N., Miller N. L., Mellon P. L. RT Phylogenetic footprinting reveals evolutionarily conserved regions of the gonadotropin-releasing hormone gene that enhance cell-specific expression. RL Mol. Endocrinol. 18:2950-2966 (2004). XX //