AC T10209
XX
ID T10209
XX
DT 01.02.2007 (created); sou.
DT 24.01.2014 (updated); jmh.
CO Copyright (C), QIAGEN.
XX
FA TTF-1
XX
SY Nkx-2.1; Nkx2.1; T/EBP; thyroid nuclear factor 1; thyroid transcription factor 1; Titf1; TTF-1.
XX
OS rat, Rattus norvegicus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G009206 Nkx2-1.
XX
CL C0053; NK-2/Nkx; 3.1.2.14.1.1.
XX
SZ 372 AA; 38.6 kDa (cDNA) (calc.).
XX
SQ MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPAAAMQQHAVGH
SQ HGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDP
SQ RFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRF
SQ KQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGG
SQ GGAGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQQQAQAAQA
SQ AAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGA
SQ MSCSTLLYGRTW
XX
SC Swiss-Prot#P23441
XX
FT 96 372 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 159 219 
PS50071; HOMEOBOX_2.
FT 161 223 
SM00389; HOX_1.
FT 162 218 
PF00046; Homeobox domain.
XX
IN T26841 Calsenilin-isoform3; mouse, Mus musculus.
IN T10274 Erm; mouse, Mus musculus.
IN T08358 GATA-4; mouse, Mus musculus.
IN T10208 GATA-6-isoform1; mouse, Mus musculus.
IN T33294 Ku70; mouse, Mus musculus.
IN T33293 Ku80; mouse, Mus musculus.
IN T15519 NF-1A; mouse, Mus musculus.
IN T01909 NF-1B2; mouse, Mus musculus.
IN T09202 NF-1C; mouse, Mus musculus.
IN T08174 NFIX2; mouse, Mus musculus.
IN T05299 NR1B1; human, Homo sapiens.
IN T14054 PARP; human, Homo sapiens.
IN T14488 PARP; mouse, Mus musculus.
IN T10518 Pax-8; Mammalia.
IN T10571 Ref-1; Mammalia.
IN T25795 TAZ-isoform1; mouse, Mus musculus.
XX
MX M01312 V$NKX21_01.
MX M00432 V$TITF1_Q3.
MX M02034 V$TTF1_Q5.
MX M03891 V$TTF1_Q5_01.
MX M00794 V$TTF1_Q6.
XX
BS R09954.
BS R09959.
BS R09960.
BS R09962.
BS R09963.
BS R55736.
BS R32430.
BS R32432.
BS R59870.
BS R04657.
BS R13138.
BS R13139.
BS R13140.
BS R12979.
BS R12981.
BS R02471.
BS R21366.
BS R21367.
BS R13202.
BS R13203.
BS R13204.
BS R13205.
BS R13206.
BS R13207.
BS R13152.
BS R13154.
BS R13155.
BS R13142.
BS R13143.
BS R13194.
BS R13193.
BS R13192.
BS R13188.
BS R13190.
BS R13191.
BS R13210.
BS R21416.
BS R05014.
BS R01879.
BS R01880.
BS R01882.
BS R08565.
BS R04322.
XX
DR TRANSPATH: MO000098020.
DR EMBL: X53858;
DR UniProtKB: P23441;
DR PDB: 1ftt.
XX
RN [1]; RE0000427.
RX PUBMED: 2583123.
RA Civitareale D., Lonigro R., Sinclair A. J., Di Lauro R.
RT A thyroid-specific nuclear protein essential for tissue-specific expression of the thyroglobulin promoter
RL EMBO J. 8:2537-2542 (1989).
RN [2]; RE0000467.
RX PUBMED: 1976511.
RA Guazzi S., Price M., de Felice M., Damante G., Mattei M., Di Lauro R.
RT Thyroid nuclear factor 1 (TTF-1) contains a homeodomain and displays a novel DNA binding specificity
RL EMBO J. 9:3631-3639 (1990).
RN [3]; RE0000696.
RX PUBMED: 1989905.
RA Avvedimento V. E., Musti A. M., Ueffing M., Obici S., Gallo A., Sanchez M., DeBrasi D., Gottesman M. E.
RT Reversible inhibition of a thyroid-specific trans-acting factor by Ras
RL Genes Dev. 5:22-28 (1991).
RN [4]; RE0001499.
RX PUBMED: 1922026.
RA Mizuno K., Gonzales F. J., Kimura S.
RT Thyroid-specific enhancer-binding protein (T/EBP): cDNA cloning, functional characterization, and structural identity with thyroid transcription factor TTF-1
RL Mol. Cell. Biol. 11:4927-4993 (1991).
RN [5]; RE0004299.
RX PUBMED: 1508216.
RA Zannini M., Francis-Lang H., Plachov D., Di Lauro R.
RT Pax-8, a paired domain-containing protein, binds to a sequence overlapping the recognition site of a homeodomain and activates transcription from two thyroid-specific promoters
RL Mol. Cell. Biol. 12:4230-4241 (1992).
RN [6]; RE0005199.
RX PUBMED: 8282100.
RA Viglino P., Fogolari F., Formisiano S., Bortolotti N., Damante G., Di Lauro R., Esposito G.
RT Structural study of rat thyroid transcription factor 1 homeodomain (TTF-1 HD) by nuclear magnetic resonance
RL FEBS Lett. 336:397-402 (1993).
RN [7]; RE0005200.
RX PUBMED: 7744853.
RA Arnone M. I., Zannini M., Di Lauro R.
RT The DNA binding actvity and the dimerization ability of the thyroid transcription factor I are redox regulated
RL J. Biol. Chem. 270:12048-12055 (1995).
RN [8]; RE0005201.
RX PUBMED: 7589789.
RA van Renterghem P. H. G., Dremier S., Vassar G., Christophe J.
RT Study of TTF1 gene expression in dog thyrocytes in primary culture
RL Mol. Cell. Endocrinol. 112:83-93 (1995).
RN [9]; RE0005202.
RX PUBMED: 1675795.
RA Damante G., Di Lauro R.
RT Several regions of Antennapedia and thyroid transcription factor 1 homeodomains contribute to DNA binding specificity
RL Proc. Natl. Acad. Sci. USA 88:5388-5392 (1991).
RN [10]; RE0005203.
RX PUBMED: 1811929.
RA Lazzaro D., Price M., de Felice M., Di Lauro R.
RT The transcription factor TTF-1 is expressed at the onset of thyroid and lung morphogenesis and in restricted regions of the foetal brain
RL Development 113:1093-1104 (1991).
RN [11]; RE0005204.
RX PUBMED: 8105464.
RA Fogolari F., Esposito F., Viglino P., Damante G., Pastore A.
RT Homology model building of the thyroid transcription factor 1 homeodoamin
RL Protein Eng. 6:513-519 (1993).
RN [12]; RE0005205.
RX PUBMED: 7915030.
RA Damante G., Fabbro D., Pellizzari L., Civitareale D., Guazzi S., Polycarpou-Schwartz M., Cauci S., Quadrifoglio F., Formisano S., Di Lauro R.
RT Sequence-specific DNA recognition by the thyroid transcription factor-1 homeodomain
RL Nucleic Acids Res. 22:3075-3083 (1994).
RN [13]; RE0005206.
RX PUBMED: 7913891.
RA Guazzi S., Lonigro R., Pintonello L., Boncinelli E., Di Lauro R., Mavilio F.
RT The thyroid transcription factor-1 gene is a candidate target for regulation by Hox proteins
RL EMBO J. 13:3339-3347 (1994).
RN [14]; RE0018174.
RX PUBMED: 11733512.
RA Liu C., Glasser S. W., Wan H., Whitsett J. A.
RT GATA-6 and thyroid transcription factor-1 directly interact and regulate surfactant protein-C gene expression.
RL J. Biol. Chem. 277:4519-4525 (2002).
RN [15]; RE0022447.
RX PUBMED: 11274148.
RA Yan C., Naltner A., Conkright J., Ghaffari M.
RT Protein-protein interaction of retinoic acid receptor alpha and thyroid transcription factor-1 in respiratory epithelial cells.
RL J. Biol. Chem. 276:21686-21691 (2001).
RN [16]; RE0025803.
RX PUBMED: 15173172.
RA Dave V., Childs T., Whitsett J. A.
RT Nuclear factor of activated T cells regulates transcription of the surfactant protein D gene (Sftpd) via direct interaction with thyroid transcription factor-1 in lung epithelial cells.
RL J. Biol. Chem. 279:34578-88 (2004).
RN [17]; RE0028945.
RX PUBMED: 11438542.
RA Missero C., Pirro M. T., Simeone S., Pischetola M., Di Lauro R.
RT The DNA glycosylase T:G mismatch-specific thymine DNA glycosylase represses thyroid transcription factor-1-activated transcription.
RL J. Biol. Chem. 276:33569-75 (2001).
RN [18]; RE0030635.
RX PUBMED: 14645514.
RA Bachurski C. J., Yang G. H., Currier T. A., Gronostajski R. M., Hong D.
RT Nuclear factor I/thyroid transcription factor 1 interactions modulate surfactant protein C transcription.
RL Mol. Cell. Biol. 23:9014-24 (2003).
RN [19]; RE0038750.
RX PUBMED: 14970209.
RA Park K. S., Whitsett J. A., Di Palma T., Hong J. H., Yaffe M. B., Zannini M.
RT TAZ interacts with TTF-1 and regulates expression of surfactant protein-C
RL J. Biol. Chem. 279:17384-90 (2004).
RN [20]; RE0049293.
RX PUBMED: 12441357.
RA Di Palma T., Nitsch R., Mascia A., Nitsch L., Di Lauro R., Zannini M.
RT The paired domain-containing factor Pax8 and the homeodomain-containing factor TTF-1 directly interact and synergistically activate transcription.
RL J. Biol. Chem. 278:3395-3402 (2003).
RN [21]; RE0049365.
RX PUBMED: 16613858.
RA Lin S., Perl A. K., Shannon J. M.
RT Erm/thyroid transcription factor 1 interactions modulate surfactant protein C transcription.
RL J. Biol. Chem. 281:16716-16726 (2006).
RN [22]; RE0049366.
RX PUBMED: 16461352.
RA Maeda Y., Hunter T. C., Loudy D. E., Dave V., Schreiber V., Whitsett J. A.
RT PARP-2 interacts with TTF-1 and regulates expression of surfactant protein-B.
RL J. Biol. Chem. 281:9600-9606 (2006).
RN [23]; RE0049367.
RX PUBMED: 15181011.
RA Rivas M., Mellstrom B., Naranjo J. R., Santisteban P.
RT Transcriptional repressor DREAM interacts with thyroid transcription factor-1 and regulates thyroglobulin gene expression.
RL J. Biol. Chem. 279:33114-33122 (2004).
RN [24]; RE0049368.
RX PUBMED: 11834746.
RA Tell G., Pines A., Paron I., D'Elia A., Bisca A., Kelley M. R., Manzini G., Damante G.
RT Redox effector factor-1 regulates the activity of thyroid transcription factor 1 by controlling the redox state of the N transcriptional activation domain.
RL J. Biol. Chem. 277:14564-14574 (2002).
RN [25]; RE0067888.
RX PUBMED: 12730191.
RA Son Y. J., Hur M. K., Ryu B. J., Park S. K., Damante G., D'Elia A. V., Costa M. E., Ojeda S. R., Lee B. J.
RT TTF-1, a homeodomain-containing transcription factor, participates in the control of body fluid homeostasis by regulating angiotensinogen gene transcription in the rat subfornical organ.
RL J. Biol. Chem. 278:27043-27052 (2003).
XX
//