
AC   T02055
XX
ID   T02055
XX
DT   28.01.1997 (created); ewi.
DT   18.10.2004 (updated); oke.
CO   Copyright (C), QIAGEN.
XX
FA   Hox11
XX
SY   Tcl-3 (human); Tlx-1.
XX
OS   mouse, Mus musculus
OC   eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE   G002690 Tlx1.
XX
CL   C0006; homeo.
XX
SZ   332 AA; 34.6 kDa (cDNA) (calc.).
XX
SQ   MEHLGPHHLHPGHAEPISFGIEQILNSPDQGGCMGPNSRLQDGDYGLGCLVPGAYTYGGG
SQ   GSAAGAGAGGTGAYGAGGPGGPGGPAGGGGGACSMGPLPGSYNVNMDLAGGPGPGGDGGG
SQ   GGAARRALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAVPGVNNLTGLTFPWME
SQ   SNRRYTKDRFTGLPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKAL
SQ   KMTDAQVKTWFQNRRTKWRRQTAEEREAESEQANRILLQLQQEAFQKSLAQPLPADPLCV
SQ   HNSSLFALQNLQPWSDDSTKITSVTSVASACE
XX
SC   Swiss-Prot#P43345
XX
FT      201    261    PS50071; HOMEOBOX_2.
FT      203    265
   PS50071; HOMEOBOX_2.
FT      203    265    SM00389; HOX_1.
FT      204    260
   SM00389; HOX_1.
FT      204    260    PF00046; Homeobox domain.
   PF00046; Homeobox domain.
 XX
SF   sequence and length conflict: 332 AA versus 284 AA [3] [4];
SF   unusual Thr residue within homeo domain recognition helix instead of Ile/Val [3];
SF   gene located on chromosome 19 [5];
SF   same optimal binding sequence as Ncx T04368 [7];
XX
CP   for expression in teeth, see [6]; neurons in developing hindbrain and spinal cord [8]; [6] [8].
XX
FF   activator [3];
FF   specifically required for spleen development [2];
FF   together with TLX3/Rnx/HOX11L2, is associated with development of somatic sensory neurons and D2/D4 dorsal interneurons [8];
XX
BS   R04970.
BS   R11090.
BS   R11091.
XX
DR   TRANSPATH: MO000026126.
DR   EMBL: L21164;
DR   EMBL: L21165;
DR   EMBL: L21166;
DR   EMBL: L21167;
DR   EMBL: L21168;
DR   EMBL: L21169;
DR   EMBL: S70629;
DR   EMBL: S70632;
DR   EMBL: S70756;
DR   UniProtKB: P43345;
XX
RN   [1]; RE0005113.
RX   PUBMED: 1681546.
RA   Kennedy M. A., Gonzalez-Sarmiento R., Kees U. R., Lampert F., Dear N., Boehm T., Rabbitts T. H.
RT   HOX11, a homeobox-containing T-cell oncogene on human chromosome 10q24
RL   Proc. Natl. Acad. Sci. USA 88:8900-8904 (1991).
RN   [2]; RE0005115.
RX   PUBMED: 7908720.
RA   Roberts C. W. M., Shutter J. R., Korsmeyer S. J.
RT   Hox11 controls the genesis of the spleen
RL   Nature 368:747-749 (1994).
RN   [3]; RE0005118.
RX   PUBMED: 8099440.
RA   Dear T. N., Sanchez-Garcia I., Rabbitts T. H.
RT   The HOX11 gene encodes a DNA-binding nuclear transcription factor belonging to a distinct family of homeobox genes
RL   Proc. Natl. Acad. Sci. USA 90:4431-4435 (1993).
RN   [4]; RE0005374.
RX   PUBMED: 7908826.
RA   Raju K., Tang S., Dube I. D., Kamel-Reid S., Bryce D. M., Breitman M. L.
RT   Characterization and developmental expression of Tlx-1, the murine homolog of HOX11
RL   Mech. Dev. 44:51-64 (1993).
RN   [5]; RE0006755.
RX   PUBMED: 7698766.
RA   Wen X. Y., Tang S., Breitman M. L.
RT   Genetic mapping of two mouse homebox genes Tlx-1 and Tlx-2 to murine chromosomes 19 and 6
RL   Genomics 24:388-390 (1994).
RN   [6]; RE0014817.
RA   Pekkanen M., Nieminen P., Sahlberg C., Aberg T., Thesleff I.
RT   Gene expression in tooth (WWW database); URL: http://bite-it.helsinki.fi/TLX1.htm
RL   Internet : (1996).
RN   [7]; RE0016874.
RX   PUBMED: 10869550.
RA   Shimizu H., Kang M., Iitsuka Y., Ichinose M., Tokuhisa T., Hatano M.
RT   Identification of an optimal Ncx binding sequence required for transcriptional activation
RL   FEBS Lett. 475:170-174 (2000).
RN   [8]; RE0023846.
RX   PUBMED: 12023301.
RA   Qian Y., Shirasawa S., Chen C. L., Cheng L., Ma Q.
RT   Proper development of relay somatic sensory neurons and D2/D4 interneurons requires homeobox genes Rnx/Tlx-3 and Tlx-1.
RL   Genes Dev. 16:1220-1233 (2002).
XX
//
XX
SF   sequence and length conflict: 332 AA versus 284 AA [3] [4];
SF   unusual Thr residue within homeo domain recognition helix instead of Ile/Val [3];
SF   gene located on chromosome 19 [5];
SF   same optimal binding sequence as Ncx T04368 [7];
XX
CP   for expression in teeth, see [6]; neurons in developing hindbrain and spinal cord [8]; [6] [8].
XX
FF   activator [3];
FF   specifically required for spleen development [2];
FF   together with TLX3/Rnx/HOX11L2, is associated with development of somatic sensory neurons and D2/D4 dorsal interneurons [8];
XX
BS   R04970.
BS   R11090.
BS   R11091.
XX
DR   TRANSPATH: MO000026126.
DR   EMBL: L21164;
DR   EMBL: L21165;
DR   EMBL: L21166;
DR   EMBL: L21167;
DR   EMBL: L21168;
DR   EMBL: L21169;
DR   EMBL: S70629;
DR   EMBL: S70632;
DR   EMBL: S70756;
DR   UniProtKB: P43345;
XX
RN   [1]; RE0005113.
RX   PUBMED: 1681546.
RA   Kennedy M. A., Gonzalez-Sarmiento R., Kees U. R., Lampert F., Dear N., Boehm T., Rabbitts T. H.
RT   HOX11, a homeobox-containing T-cell oncogene on human chromosome 10q24
RL   Proc. Natl. Acad. Sci. USA 88:8900-8904 (1991).
RN   [2]; RE0005115.
RX   PUBMED: 7908720.
RA   Roberts C. W. M., Shutter J. R., Korsmeyer S. J.
RT   Hox11 controls the genesis of the spleen
RL   Nature 368:747-749 (1994).
RN   [3]; RE0005118.
RX   PUBMED: 8099440.
RA   Dear T. N., Sanchez-Garcia I., Rabbitts T. H.
RT   The HOX11 gene encodes a DNA-binding nuclear transcription factor belonging to a distinct family of homeobox genes
RL   Proc. Natl. Acad. Sci. USA 90:4431-4435 (1993).
RN   [4]; RE0005374.
RX   PUBMED: 7908826.
RA   Raju K., Tang S., Dube I. D., Kamel-Reid S., Bryce D. M., Breitman M. L.
RT   Characterization and developmental expression of Tlx-1, the murine homolog of HOX11
RL   Mech. Dev. 44:51-64 (1993).
RN   [5]; RE0006755.
RX   PUBMED: 7698766.
RA   Wen X. Y., Tang S., Breitman M. L.
RT   Genetic mapping of two mouse homebox genes Tlx-1 and Tlx-2 to murine chromosomes 19 and 6
RL   Genomics 24:388-390 (1994).
RN   [6]; RE0014817.
RA   Pekkanen M., Nieminen P., Sahlberg C., Aberg T., Thesleff I.
RT   Gene expression in tooth (WWW database); URL: http://bite-it.helsinki.fi/TLX1.htm
RL   Internet : (1996).
RN   [7]; RE0016874.
RX   PUBMED: 10869550.
RA   Shimizu H., Kang M., Iitsuka Y., Ichinose M., Tokuhisa T., Hatano M.
RT   Identification of an optimal Ncx binding sequence required for transcriptional activation
RL   FEBS Lett. 475:170-174 (2000).
RN   [8]; RE0023846.
RX   PUBMED: 12023301.
RA   Qian Y., Shirasawa S., Chen C. L., Cheng L., Ma Q.
RT   Proper development of relay somatic sensory neurons and D2/D4 interneurons requires homeobox genes Rnx/Tlx-3 and Tlx-1.
RL   Genes Dev. 16:1220-1233 (2002).
XX
//