TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02055 XX ID T02055 XX DT 28.01.1997 (created); ewi. DT 18.10.2004 (updated); oke. CO Copyright (C), QIAGEN. XX FA Hox11 XX SY Tcl-3 (human); Tlx-1. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002690 Tlx1. XX CL C0006; homeo. XX SZ 332 AA; 34.6 kDa (cDNA) (calc.). XX SQ MEHLGPHHLHPGHAEPISFGIEQILNSPDQGGCMGPNSRLQDGDYGLGCLVPGAYTYGGG SQ GSAAGAGAGGTGAYGAGGPGGPGGPAGGGGGACSMGPLPGSYNVNMDLAGGPGPGGDGGG SQ GGAARRALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAVPGVNNLTGLTFPWME SQ SNRRYTKDRFTGLPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKAL SQ KMTDAQVKTWFQNRRTKWRRQTAEEREAESEQANRILLQLQQEAFQKSLAQPLPADPLCV SQ HNSSLFALQNLQPWSDDSTKITSVTSVASACE XX SC Swiss-Prot#P43345 XX FT 201 261 PS50071; HOMEOBOX_2. FT 203 265 SM00389; HOX_1. FT 204 260 PF00046; Homeobox domain. XX SF sequence and length conflict: 332 AA versus 284 AA [3] [4]; SF unusual Thr residue within homeo domain recognition helix instead of Ile/Val [3]; SF gene located on chromosome 19 [5]; SF same optimal binding sequence as Ncx T04368 [7]; XX CP for expression in teeth, see [6]; neurons in developing hindbrain and spinal cord [8]; [6] [8]. XX FF activator [3]; FF specifically required for spleen development [2]; FF together with TLX3/Rnx/HOX11L2, is associated with development of somatic sensory neurons and D2/D4 dorsal interneurons [8]; XX BS R04970. BS R11090. BS R11091. XX DR TRANSPATH: MO000026126. DR EMBL: L21164; DR EMBL: L21165; DR EMBL: L21166; DR EMBL: L21167; DR EMBL: L21168; DR EMBL: L21169; DR EMBL: S70629; DR EMBL: S70632; DR EMBL: S70756; DR UniProtKB: P43345; XX RN [1]; RE0005113. RX PUBMED: 1681546. RA Kennedy M. A., Gonzalez-Sarmiento R., Kees U. R., Lampert F., Dear N., Boehm T., Rabbitts T. H. RT HOX11, a homeobox-containing T-cell oncogene on human chromosome 10q24 RL Proc. Natl. Acad. Sci. USA 88:8900-8904 (1991). RN [2]; RE0005115. RX PUBMED: 7908720. RA Roberts C. W. M., Shutter J. R., Korsmeyer S. J. RT Hox11 controls the genesis of the spleen RL Nature 368:747-749 (1994). RN [3]; RE0005118. RX PUBMED: 8099440. RA Dear T. N., Sanchez-Garcia I., Rabbitts T. H. RT The HOX11 gene encodes a DNA-binding nuclear transcription factor belonging to a distinct family of homeobox genes RL Proc. Natl. Acad. Sci. USA 90:4431-4435 (1993). RN [4]; RE0005374. RX PUBMED: 7908826. RA Raju K., Tang S., Dube I. D., Kamel-Reid S., Bryce D. M., Breitman M. L. RT Characterization and developmental expression of Tlx-1, the murine homolog of HOX11 RL Mech. Dev. 44:51-64 (1993). RN [5]; RE0006755. RX PUBMED: 7698766. RA Wen X. Y., Tang S., Breitman M. L. RT Genetic mapping of two mouse homebox genes Tlx-1 and Tlx-2 to murine chromosomes 19 and 6 RL Genomics 24:388-390 (1994). RN [6]; RE0014817. RA Pekkanen M., Nieminen P., Sahlberg C., Aberg T., Thesleff I. RT Gene expression in tooth (WWW database); URL: http://bite-it.helsinki.fi/TLX1.htm RL Internet : (1996). RN [7]; RE0016874. RX PUBMED: 10869550. RA Shimizu H., Kang M., Iitsuka Y., Ichinose M., Tokuhisa T., Hatano M. RT Identification of an optimal Ncx binding sequence required for transcriptional activation RL FEBS Lett. 475:170-174 (2000). RN [8]; RE0023846. RX PUBMED: 12023301. RA Qian Y., Shirasawa S., Chen C. L., Cheng L., Ma Q. RT Proper development of relay somatic sensory neurons and D2/D4 interneurons requires homeobox genes Rnx/Tlx-3 and Tlx-1. RL Genes Dev. 16:1220-1233 (2002). XX //