TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02061 XX ID T02061 XX DT 28.01.1997 (created); ewi. DT 30.12.2011 (updated); grs. CO Copyright (C), QIAGEN. XX FA PMX1-isoform2 XX SY MHox; Paired-like homeobox; Phox-1; Pmx; PMX1-A. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G014322 Prrx1. XX CL C0006; homeo; 3.1.3.21.1.1. XX SZ 217 AA; 24.4 kDa (cDNA) (calc.), 35 kDa (SDS) [1] XX SQ MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADESVGEA SQ GRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPD SQ AFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIV SQ PRPAPRPTDYLSWGTASPYRSSSLPRCCLHEGLHNGF XX SC Swiss-Prot#P43271-2 XX FT 92 152 PS50071; HOMEOBOX_2. FT 94 150 PS50552; PAX. FT 94 156 SM00389; HOX_1. FT 95 151 PF00046; Homeobox domain. XX SF splice variant K-2a T02060 differs in its C-terminus [2]; SF homeo domain most similar to that of S8 (97% identity), suggested to constitute an own subclass of paired-type homeo domains [2]; XX CP embryo: mesenchymal cells in craniofacial, pericardial, primitive dermal, prevertebral, and genital structures [2], visceral arch, limb bud [1]; adult: heart, skeletal muscle, uterus [1] [1] [2]. CN intestine, kidney, liver, pancreas, spleen, stomach [1]. XX FF expression during embryogenesis is restricted to mesodermal cell types, highest levels in limb buds and visceral arches [1]; XX MX M01348 V$K2B_01. MX M03560 V$PMX1_Q6. XX DR TRANSPATH: MO000026130. DR EMBL: L06502; DR EMBL: X59726; DR UniProtKB: P63013-2; XX RN [1]; RE0005123. RX PUBMED: 1360403. RA Cserjesi P., Lilly B., Bryson L. J., Wang Y., Sassoon D. A., Olson E. N. RT MHox: a mesodermally restricted homeodomain protein that binds an essential site in the muscle creatine kinase enhancer RL Development 115:1087-1101 (1992). RN [2]; RE0005125. RX PUBMED: 1383943. RA Kern M. J., Witte D. P., Valerius M. T., Aronow B. J., Potter S. S. RT A novel murine homeobox gene isolated by a tissue specific PCR cloning strategy RL Nucleic Acids Res. 20:5189-5195 (1992). RN [3]; RE0067849. RX PUBMED: 12741393. RA McKean D. M., Sisbarro L., Ilic D., Kaplan-Alburquerque N., Nemenoff R., Weiser-Evans M., Kern M. J., Jones P. L. RT FAK induces expression of Prx1 to promote tenascin-C-dependent fibroblast migration. RL J. Cell Biol. 161:393-402 (2003). XX //