AC T02216
XX
ID T02216
XX
DT 20.10.1997 (created); ewi.
DT 20.08.2008 (updated); ada.
CO Copyright (C), QIAGEN.
XX
FA TFIIA-alpha/beta precursor (major)
XX
SY general transcription factor IIA, 1, 19/37kDa; GTF2A1; TF2A1; TFIIA; TFIIA-L; TFIIA-LN/LC.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G003992 GTF2A1; HGNC: GTF2A1.
XX
HO TFIIA-L (Drosophila), TOA1 (yeast).
XX
SZ 376 AA; 41.5 kDa (cDNA) (calc.), 38 kDa (alpha, SDS) [7], 37 kDa (alpha, SDS) [5], 35 kDa (alpha, SDS) [6], 20 kDa (beta, SDS), 19 kDa (beta, SDS) [5] [6] [6] [5] [7]
XX
SQ MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFH
SQ SEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIV
SQ PDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQ
SQ SVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTV
SQ AAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKE
SQ KDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNL
SQ NGRDYIFSKAIGDAEW
XX
SC Swiss-Prot#P52655-1
XX
FT 1 39 
missing in alternative translation initiation product [5].
FT 1 376 
PF03153; Transcription factor IIA, alpha/beta subunit.
FT 104 352 
PF00478; IMP dehydrogenase / GMP reductase domain.
XX
SF the N-terminal part represents the alpha, the C-terminal part the beta subunit, the processing point being located around position 275 [5] [6] [9];
SF pI(calc.) = 4.25 [5];
SF processing is no prerequisite for functional assembly with the gamma subunit [3] [4];
SF the alpha subunit interacts with the gamma chain, the beta subunit interacts with TBP [4];
XX
CP (HeLa).
EX adrenal gland (right and left),,,adult; high; gel shift (RNA); mRNA (poly-A); [11].
EX amygdaloid body,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX aorta,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX appendix,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX bone marrow,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX brain,,,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX brain,,,adult; high; gel shift (RNA); mRNA (poly-A); [11].
EX brain,,,fetal; medium; gel shift (RNA); mRNA (poly-A); [11].
EX caudate nucleus,,,adult; high; gel shift (RNA); mRNA (poly-A); [11].
EX cerebellum,,,adult; very high; gel shift (RNA); mRNA (poly-A); [11].
EX cerebral cortex of cerebral hemisphere,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX cerebral cortex,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX colon,,,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX colon,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX frontal lobe of medial and inferior surfaces,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX frontal lobe of superolateral face,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX heart,,,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX heart,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX heart,,,fetal; low; gel shift (RNA); mRNA (poly-A); [11].
EX hippocampus,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX kidney (right and left),,,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX kidney (right and left),,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX kidney (right and left),,,fetal; low; gel shift (RNA); mRNA (poly-A); [11].
EX liver,,,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX liver,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX liver,,,fetal; low; gel shift (RNA); mRNA (poly-A); [11].
EX lung (right and left),,,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX lung (right and left),,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX lung (right and left),,,fetal; low; gel shift (RNA); mRNA (poly-A); [11].
EX lymph node,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX major salivary glands,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX mammary gland,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX minor salivary glands,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX muscles,,,adult; high; Northern blot; mRNA (poly-A); [11].
EX muscles,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX myelencephalon,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX nucleus accumbens,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX occipital lobe of medial and inferior surfaces,,,adult; very high; gel shift (RNA); mRNA (poly-A); [11].
EX occipital lobe of superolateral face,,,adult; very high; gel shift (RNA); mRNA (poly-A); [11].
EX ovary (right and left),,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX pancreas,,,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX pancreas,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX pituitary gland of diencephalon,,,adult; high; gel shift (RNA); mRNA (poly-A); [11].
EX placenta,,,adult; high; Northern blot; mRNA (poly-A); [11].
EX placenta,,,adult; very high; gel shift (RNA); mRNA (poly-A); [11].
EX prostate gland,,,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX prostate gland,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX putamen,,,adult; high; gel shift (RNA); mRNA (poly-A); [11].
EX small intestine,,,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX small intestine,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX spinal cord,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX spleen,,,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX spleen,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX spleen,,,fetal; low; gel shift (RNA); mRNA (poly-A); [11].
EX stomach,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX substantia nigra,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX temporal lobe of medial and inferior surfaces,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX temporal lobe of superolateral face,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX testis (right and left),,,adult; high; Northern blot; mRNA (poly-A); [11].
EX testis (right and left),,,adult; very high; gel shift (RNA); mRNA (poly-A); [11].
EX thalamus,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX thymus,,,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX thymus,,,adult; high; gel shift (RNA); mRNA (poly-A); [11].
EX thymus,,,fetal; low; gel shift (RNA); mRNA (poly-A); [11].
EX thyroid gland,,,adult; high; gel shift (RNA); mRNA (poly-A); [11].
EX trachea,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX tubular salivary gland,,,adult; medium; gel shift (RNA); mRNA (poly-A); [11].
EX urinary bladder,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
EX uterus,,,adult; detectable; Northern blot; mRNA (poly-A); [11].
EX uterus,,,adult; low; gel shift (RNA); mRNA (poly-A); [11].
XX
FF holo-TFIIA binds to and stabilizes TFIID/TBP-TATA box-complexes [1];
FF functions as antirepressor and activator by displacing inhibiting TFIID-components and interacting with some other TFIID components [4] [5] [8];
FF the alpha-subunit specifically mediates effects of upstream activators onto the basal transcription complex, but is dispensable for antirepression [10];
XX
IN T02224 TFIIA-gamma; human, Homo sapiens.
XX
MX M00707 V$TFIIA_Q6.
XX
BS R00996.
BS R01002.
BS R01015.
BS R01016.
BS R01017.
BS R01018.
BS R01605.
BS R03170.
BS R00705.
XX
DR TRANSPATH: MO000013248.
DR EMBL: D14886;
DR EMBL: D14887;
DR EMBL: X75383;
DR EMBL: X77225;
DR UniProtKB: P52655-1;
XX
RN [1]; RE0000875.
RX PUBMED: 3818643.
RA Reinberg D., Horikoshi M., Roeder R. G.
RT Factors involved in specific transcription by mammalian RNA polymerase II. Functional analysis of initiation factors IIA and IID and identification of a new factor operating at sequences downstream of the initiation site
RL J. Biol. Chem. 262:3322-3330 (1987).
RN [2]; RE0005655.
RX PUBMED: 1729613.
RA Cortes P., Flores O., Reinberg D.
RT Factors involved in specific transcription by mammalian RNA polymerase II: Purification and analysis of transcription factor IIA and identification of transcription factor IIJ
RL Mol. Cell. Biol. 12:413-421 (1992).
RN [3]; RE0005656.
RX PUBMED: 7958899.
RA Ozer J., Moore P. A., Bolden A. H., Lee A., Rosen C. A., Lieberman P. M.
RT Molecular cloning of the small (gamma) subunit of human TFIIA reveals functions critical for activated transcription
RL Genes Dev. 8:2324-2335 (1994).
RN [4]; RE0005657.
RX PUBMED: 7958900.
RA Sun X., Ma D., Sheldon M., Yeung K., Reinberg D.
RT Reconstitution of human TFIIA activity from recombinant polypeptides: a role in TFIID-mediated transcription
RL Genes Dev. 8:2336-2348 (1994).
RN [5]; RE0005658.
RX PUBMED: 8224850.
RA Ma D., Watanabe H., Mermelstein F., Admon A., Oguri K., Sun X., Wada T., Imai T., Shiroya T., Reinberg D., Handa H.
RT Isolation of a cDNA encoding the largest subunit of TFIIA reveals functions important for activated transcription
RL Genes Dev. 7:2246-2257 (1993).
RN [6]; RE0005659.
RX PUBMED: 8224848.
RA Dejong J., Roeder R. G.
RT A single cDNA hTFIIA/alpha encodes both the p35 and p19 subunits of human TFIIA
RL Genes Dev. 7:2220-2234 (1993).
RN [7]; RE0005660.
RX PUBMED: 2065666.
RA Usuda Y., Kubota A., Berk A. J., Handa H.
RT Affinity purification of transcription factor IIA from HeLa cell nuclear extracts
RL EMBO J. 10:2305-2310 (1991).
RN [8]; RE0005662.
RX PUBMED: 8396729.
RA Merino A., Madden K. R., Lane W. S., Champoux J. J., Reinberg D.
RT DNA topoisomerase I is involved in both repression and activation of transcription
RL Nature 365:227-232 (1993).
RN [9]; RE0005663.
RX PUBMED: 7724559.
RA Dejong J., Bernstein R., Roeder R. G.
RT Human general transcription factor TFIIA: Characterization of a cDNA encoding the small subunit and requirement for basal and activated transcription
RL Proc. Natl. Acad. Sci. USA 92:3313-3317 (1995).
RN [10]; RE0005664.
RX PUBMED: 8692860.
RA Ma D., Olave I., Merino A., Reinberg D.
RT Separation of the transcriptional coactivator and antirepression functions of transcription factor IIA
RL Proc. Natl. Acad. Sci. USA 93:6583-6588 (1996).
RN [11]; RE0017409.
RX PUBMED: 10364255.
RA Upadhyaya A. B., Lee S. H., Dejong J.
RT Identification of a general transcription factor TFIIAalpha/beta homolog selectively expressed in testis
RL J. Biol. Chem. 274:18040-18048 (1999).
XX
//