TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02221 XX ID T02221 XX DT 23.10.1997 (created); ili. CO Copyright (C), QIAGEN. XX FA Bro XX SY Brother. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX HO PEBP2beta, CBFbeta. XX SZ 177 AA; 20.9 kDa (cDNA) (calc.). XX SQ MPRVVPDQRSKFDSDELFRRLSRESEVRYTGYRERAMEERRMRFVNDCRKGYAEISMVAS SQ GTNLQLYFNANHNPYAQEQDCDFERERGKVHLRSSFIMNGVCVRFRGWVDLDRLDGAACL SQ DFDEQRAQQEDAQLQEQIQSYNQRMAESRRIYHTPQTPPEDHHHRGGPSLPRGPMGW XX SC Swiss-Prot#Q24039 XX FT 1 170 PF02312; Core binding factor beta subunit. XX CN pole cells. XX FF enhances the DNA-binding activity of Runt [1]; FF region homologous to mammalian PEBP2beta is necessary for interaction with Runt [1]; FF the complexes formed with Bro and Runt are associated with a DNA bend of 61� [1]; FF expressed in embryogenesis of Drosophila [1]; XX IN T01066 runt; fruit fly, Drosophila melanogaster. XX DR TRANSPATH: MO000026236. DR EMBL: U22176; DR UniProtKB: Q24039; DR FLYBASE: FBgn0013755; Bro. XX RN [1]; RE0005912. RX PUBMED: 8622696. RA Golling G., Li L., Pepling M., Stebbins M., Gergen J. P. RT Drosophila homologs of the proto-oncogene product PEBP2/CBFbeta regulate the DNA-binding properties of Runt RL Mol. Cell. Biol. 16:932-942 (1996). XX //