TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01066 XX ID T01066 XX DT 24.02.1994 (created); ewi. DT 21.02.2000 (updated); ewi. CO Copyright (C), QIAGEN. XX FA runt XX SY runt. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX CL C0029; runt. XX SZ 509 AA; 53.3 kDa (cDNA) (calc.). XX SQ MHLPAGPTMVANNTQVLAAAAAAAAAAAAVAQGPGPQQSSNATTASAIAINPAQSLANTS SQ THSASSTGSSTPDLSTNNTSSSSNATTSPQNSAKMPSSMTDMFASLHEMLQEYHGELAQT SQ GSPSILCSALPNHWRSNKSLPGAFKVIALDDWPDGTLVSIKCGNDENYCGELRNCTTTMK SQ NQVAKFNDLRFVGRSGRGKSFTLTITIATYPVQIASYSKAIKVTVDGPREPRSKQSYGYP SQ HPGAFNPFMLNPAWLDAAYMTYGYADYFRHQAAAQAAQVHHPALAKSSASSVSPNPNPSV SQ ATSSSSAVQPSEYPHPAAAVAAAAGQPSAMMPSPPGAAPATPYAIPQFPFNHVAAAAAAK SQ AATPHAFHPYNFAAAAGLRARNAALHHQSEPVHVSPASSRPSSSSPTQQHVLLKLNTSIE SQ TSSIHEQSASDGDSDDEQIDVVKSEFDLDKSLDVAPLRMRCDLKAPSSMKPLYHESGPGA SQ VANSRQPSPETTTKIKSAAVQQKTVWRPY XX SC Swiss-Prot#P22814 XX FT 41 506 PF00478; IMP dehydrogenase / GMP reductase domain. FT 103 237 PF00853; Runt domain. FT 105 233 PS51062; RUNT. XX FF segmentation gene [1]; FF act as a direct repressor of hairy, albeit two stripes [2]; FF repress even-skipped (eve) gene expression [2]; FF repressed by promoter-bound Hairy [2]; FF interaction with Groucho is important for the VWRPY-dependent repression activities of runt [3]; FF a second repression activity is independent of this conserved C-terminal sequence [3]; XX IN T02222 Bgb; fruit fly, Drosophila melanogaster. IN T02221 Bro; fruit fly, Drosophila melanogaster. IN T02451 groucho; fruit fly, Drosophila melanogaster. XX MX M02360 I$RUNBGB_01. XX DR TRANSPATH: MO000045971. DR EMBL: X56432; DMRUNTR. DR UniProtKB: P22814; RUNT_DROME. DR FLYBASE: FBgn0003300; run. XX RN [1]; RE0002540. RX PUBMED: 8341710. RA Ogawa E., Maruyama M., Kagoshima H., Inuzuka M., Lu J., Satake M., Shigesada K., Ito Y. RT PEBP2/PEA2 represents a family of transcription factors homologous to the products of the Drosophila runt gene and the human AML1 gene RL Proc. Natl. Acad. Sci. USA 90:6859-6863 (1993). RN [2]; RE0006086. RX PUBMED: 9003784. RA Jimenez G., Pinchin S. M., Ish-Horowicz D. RT In vitro interactions of the Drosophila Hairy and Runt transcriptional repressors with target promoters RL EMBO J. 15:7088-7098 (1996). RN [3]; RE0006216. RX PUBMED: 9271433. RA Aronson B. D., Fisher A. L., Blechman K., Caudy M., Gergen J. P. RT Groucho-dependent and -independent repression activities of runt domain proteins RL Mol. Biol. Cell 17:5581-5587 (1997). XX //