TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02222 XX ID T02222 XX DT 23.10.1997 (created); ili. DT 11.07.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Bgb XX SY Big-brother. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX HO Bro, PEBP2beta, CBFbeta. XX SZ 213 AA; 25.2 kDa (cDNA) (calc.). XX SQ MMNEAALANMIPYDTIGLYEQPKPRFIFKMPRVVPDQKSKFESDELFRRLSRESEVRYTG SQ YRERSIEERQVRFMNGCREGHTEASFVASGTNLQLVFNANQNPYLHDKECDFDKEHGKVH SQ IKSYFIMNGVCVRFRGWIDLERLDGVGCLEYDERRAMHEDAILRDQIDRYNQRLREFEDT SQ KRAYRDNRQDEMEAVRRGVASGGIGVGASMWRR XX SC Swiss-Prot#Q24040 XX FT 1 175 PF02312; Core binding factor beta subunit. XX FF enhance the DNA-binding activity of Runt [1]; FF region homologous to mammalian PEBP2beta is necessary for interaction with Runt [1]; FF the complexes formed with Bgb and Runt are associated with a DNA bend [1]; FF expressed in embryogenesis of Drosophila [1]; FF Bgb shows a distinct expression pattern that overlaps temporally with Bro [1]; XX IN T01066 runt; fruit fly, Drosophila melanogaster. XX MX M02360 I$RUNBGB_01. XX DR TRANSPATH: MO000026237. DR EMBL: U22177; DR UniProtKB: Q24040; DR FLYBASE: FBgn0013753; Bgb. XX RN [1]; RE0005912. RX PUBMED: 8622696. RA Golling G., Li L., Pepling M., Stebbins M., Gergen J. P. RT Drosophila homologs of the proto-oncogene product PEBP2/CBFbeta regulate the DNA-binding properties of Runt RL Mol. Cell. Biol. 16:932-942 (1996). XX //