TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02227 XX ID T02227 XX DT 24.10.1997 (created); ewi. DT 29.11.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Toa1p XX SY TFIIA (32 kDa subunit); TOA1; TOA1p; YOR194C. XX OS yeast, Saccharomyces cerevisiae OC Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. XX GE G004249 TOA1. XX HO TFIIA-alpha/beta (human), TFII-L (Drosophila). XX SZ 286 AA; 32.2 kDa (gene) (calc.), 32 kDa (SDS) [2], 43 kDa (SDS) [1] [1] [2] XX SQ MSNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTFSWDNQF SQ NEGNINGVQNDLNFNLATPGVNSSEFNIKEENTGNEGLILPNINSNNNIPHSGETNINTN SQ TVEATNNSGATLNTNTSGNTNADVTSQPKIEVKPEIELTINNANITTVENIDDESEKKDD SQ EEKEEDVEKTRKEKEQIEQVKLQAKKEKRSALLDTDEVGSELDDSDDDYLISEGEEDGPD SQ ENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV XX SC Swiss-Prot#P32773 XX FT 1 54 required for subunit association and TBP-TATA-binding [3]. FT 1 285 PF03153; Transcription factor IIA, alpha/beta subunit. FT 217 286 required for TBP-TATA-binding [3]. FT 241 286 required for subunit association [3]. XX SF pI(calc.) = 4.1 [1]; SF outmost N- and C-terminal parts exhibit significant homology with corresponding parts of human TFIIA-alpha/beta (39% and 44% identity, resp.) and are important for TFIIA function [3]; XX IN T02228 Toa2p; yeast, Saccharomyces cerevisiae. XX BS R01015. BS R01016. BS R00970. XX DR EMBL: M85248; SCTFIIAA. DR UniProtKB: P32773; TOA1_YEAST. XX RN [1]; RE0005668. RX PUBMED: 1546313. RA Ranish J. A., Lane W. S., Hahn S. RT Isolation of two genes that encode subunits of the yeast transcription factor IIA RL Science 255:1127-1129 (1992). RN [2]; RE0005669. RX PUBMED: 1918049. RA Ranish J. A., Hahn S. RT The yeast general transcription factor TFIIA is composed of two polypeptide subunits RL J. Biol. Chem. 266:19320-19327 (1991). RN [3]; RE0005672. RX PUBMED: 7862117. RA Kang J. J., Auble D. T., Ranish J. A., Hahn S. RT Analysis of the yeast transcription factor TFIIA: Distinct functional regions and a polymerase II-specific role in basal and activated transcription RL Mol. Cell. Biol. 15:1234-1243 (1995). XX //