TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02228 XX ID T02228 XX DT 24.10.1997 (created); ewi. DT 29.11.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Toa2p XX SY TFIIA (13.5 kDa subunit); TOA2; TOA2p; YKL058W. XX OS yeast, Saccharomyces cerevisiae OC Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. XX GE G004250 TOA2. XX HO TFIIA-gamma (human), TFII-S (Drosophila). XX SZ 122 AA; 13.5 kDa (gene) (calc.), 13.5 kDa (SDS) [2], 13 kDa (SDS) [1] [1] [2] XX SQ MAVPGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKL SQ TVKGNLDTYGFCDDVWTFIVKNCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVACNSKK SQ SE XX SC Swiss-Prot#P32774 XX FT 5 53 PF02268; Transcription initiation factor IIA, ga. FT 55 118 PF02751; Transcription initiation factor IIA, ga. XX SF small subunit of TFIIA [2]; SF pI(calc.) = 4.8 [1]; SF except positions 92-100, the whole Toa2p molecule is required for TFIIA function [4]; XX IN T02227 Toa1p; yeast, Saccharomyces cerevisiae. XX BS R01015. BS R01016. BS R00970. XX DR EMBL: M85249; SCTFIIAB. DR EMBL: X75781; SCXI286K. DR EMBL: Z28058; SCYKL058W. DR UniProtKB: P32774; TOA2_YEAST. XX RN [1]; RE0005668. RX PUBMED: 1546313. RA Ranish J. A., Lane W. S., Hahn S. RT Isolation of two genes that encode subunits of the yeast transcription factor IIA RL Science 255:1127-1129 (1992). RN [2]; RE0005669. RX PUBMED: 1918049. RA Ranish J. A., Hahn S. RT The yeast general transcription factor TFIIA is composed of two polypeptide subunits RL J. Biol. Chem. 266:19320-19327 (1991). RN [3]; RE0005670. RX PUBMED: 8091863. RA Rasmussen S. W. RT Sequence of a 28.6 kb Region of Yeast Chromosome XI Includes the FAB1 and TOA2 Genes, an Open Reading Frame (ORF) Similar to a Translationally Controlled Tumor Protein, one ORF Containing Motifs also Found in Plant Storage Proteins. RL Yeast 10:69-74 (1994). RN [4]; RE0005672. RX PUBMED: 7862117. RA Kang J. J., Auble D. T., Ranish J. A., Hahn S. RT Analysis of the yeast transcription factor TFIIA: Distinct functional regions and a polymerase II-specific role in basal and activated transcription RL Mol. Cell. Biol. 15:1234-1243 (1995). XX //