TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02241 XX ID T02241 XX DT 27.10.1997 (created); ili. DT 30.04.2013 (updated); prb. CO Copyright (C), QIAGEN. XX FA PEBP2alphaB2 XX SY AML1; CBFA2; PEBP2alphaB. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G005053 Runx1. XX CL C0029; runt. XX SZ 387 AA; 41.3 kDa (cDNA) (calc.). XX SQ MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDGGPALASKLRSGDRSMVEVLADHPG SQ ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA SQ TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRNAR SQ QIQPSPPWSYDQSYQYLGSITSSSVHPATPISPGRASGMTSLSAELSSRLSTAPDLTAFG SQ DPRQFPTLPSISDPRMHYPGAFTYSPPVTSGIGIGMSAMSSASRYHTYLPPPYPGSSQAQ SQ AGPFQTGSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGAALLNPSLPSQSDV SQ VETEGSHSNSPTNMPPARLEEAVWRPY XX SC translated from EMBL #D26532 XX FT 48 182 PF00853; Runt domain. FT 50 178 PS51062; RUNT. FT 66 373 PF00478; IMP dehydrogenase / GMP reductase domain. FT 260 289 putative nuclear matrix targeting signal [4]. XX SF splice variant: PEBP2alphaB1 T02235, in which N178 is replaced by R and contains an insertion of 64 AA at position 179 [1]; SF similar to chicken factor T02253 [3]; XX CP T lymphocytes [2]. EX skeleton of forelimb,,,Theiler Stage 26; none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [5]. EX skeleton of hindlimb,,,Theiler Stage 26; none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [5]. XX FF activator; FF less active than PEBP2alphaB1, but binds to DNA two to three times more strongly [1]; FF binds to DNA through PEBP2 site [1]; FF expression is tissue type dependent [2]; FF believed to be involved in T-cell-specific gene expression [2]; XX IN T01065 PEBP2beta-isoform2; mouse, Mus musculus. XX MX M00271 V$AML1_01. MX M01658 V$AML1_Q4. MX M07242 V$AML1_Q4_01. MX M08865 V$AML1_Q4_02. MX M02084 V$AML1_Q5. MX M08866 V$AML_Q4. MX M00769 V$AML_Q6. MX M00984 V$PEBP_Q6. XX BS R01222. XX DR TRANSPATH: MO000026249. DR EMBL: D26532; DR UniProtKB: Q03347-2; XX RN [1]; RE0006065. RX PUBMED: 8164679. RA Bae S., Ogawa E., Maruyama M., Oka H., Satake M., Shigesada K., Jenkins N. A., Gilbert D. J., Copelands N. G., Ito Y. RT PEBP2alphaB / mouse AML1 consists of multiple isoforms that possess differential transactivation potentials RL Mol. Biol. Cell 14:3242-3252 (1994). RN [2]; RE0006071. RX PUBMED: 7862157. RA Satake M., Nomura S., Yamaguchi-Iwai Y., Takahama Y., Hashimoto Y., Niki M., Kitamura Y., Ito Y. RT Expression of the Runt domain-encoding PEBP2alpha genes in T cells during thymic development RL Mol. Cell. Biol. 15:1662-1670 (1995). RN [3]; RE0006085. RX PUBMED: 8601397. RA Castagnola P., Gennari M., Gaggero A., Rossi F., Daga A., Corsetti M. T., Calabi F., Cancedda R. RT Expression of runtB is modulated during chondrocyte differentiation RL Exp. Cell Res. 223:215-226 (1996). RN [4]; RE0006488. RX PUBMED: 9192636. RA Zeng C., van Wijnen A. J., Stein J. L., Meyers S., Sun W., Shopland L., Lawrence J. B., Penman S., Lian J.B., Stein G. S., Hiebert S. W. RT Identification of a nuclear matrix targeting signal in leukemia and bone-related AML/CBF-alpha transcription factors RL Proc. Natl. Acad. Sci. USA 94:6746-6751 (1997). RN [5]; RE0035530. RX PUBMED: 9794229. RA Sato M., Morii E., Komori T., Kawahata H., Sugimoto M., Terai K., Shimizu H., Yasui T., Ogihara H., Yasui N., Ochi T., Kitamura Y., Ito Y., Nomura S. RT Transcriptional regulation of osteopontin gene in vivo by PEBP2alphaA/CBFA1 and ETS1 in the skeletal tissues. RL Oncogene 17:1517-1525 (1998). XX //