TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02747 XX ID T02747 XX DT 03.06.1999 (created); mpr. DT 20.02.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA REVERB-beta XX SY BD73; EAR-1b; EAR1b; NR1D2; orphan nuclear hormone receptor BD73; rev-erb beta; rev-erb-beta; REVERBb. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G006488 NR1D2; HGNC: NR1D2. XX CL C0002; CC (rec). XX SZ 579 AA; 64.6 kDa (calc.). XX SQ MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDL SQ ANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHAC SQ EGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIP SQ KREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKS SQ SSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH SQ CGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPI SQ DGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFA SQ KRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAG SQ DLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLI SQ MKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP XX SC translated from EMBL #D16815 XX FT 100 172 SM00399; c4gold. FT 100 176 PS51030; NUCLEAR_REC_DBD_2. FT 101 177 PF00105; Zinc finger, C4 type (two domains). FT 204 546 PF00478; IMP dehydrogenase / GMP reductase domai. FT 407 565 SM00430; holi. FT 410 577 PF00104; Ligand-binding domain of nuclear hormon. XX SF shows high sequence similarity to T02746 [3]; SF binds as a monomer to a DNA sequence which consists of a specific A/T-rich sequence [3]; SF A box, a sequence which has been suggested to mediate monomer binding by other superfamily members, lies closer to the DNA-binding domain than in other nuclear receptors [3]; XX CP expressed in many organs and cell lines (e.g. HepG2 cells) [3]. XX FF may function (like other members of the Rev-erb family) as a repressor of transcription, compare to [1] [3]; XX DR TRANSPATH: MO000026722. DR EMBL: D16815; DR UniProtKB: Q14995; XX RN [1]; RE0010605. RX PUBMED: 7651396. RA Harding H. P., Lazar M. A. RT The monomer-binding orphan receptor Rev-Erb represses transcription as a dimer on a novel direct repeat RL Mol. Cell. Biol. 15:4791-4802 (1995). RN [2]; RE0013625. RX PUBMED: 10219237. RA Nuclear Receptors Nomenclature Committee. RT A unified nomenclature system for the nuclear receptor superfamily RL Cell 97:161-163 (1999). RN [3]; RE0013633. RX PUBMED: 7997240. RA Dumas B., Harding H. P., Choi H. S., Lehmann K. A., Chung M., Lazar M. A., Moore D. D. RT A new orphan member of the nuclear hormone receptor superfamily closely related to Rev-Erb RL Mol. Endocrinol. 8:996-1005 (1994). XX //