TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02758 AS T00012. XX ID T02758 XX DT 07.06.1999 (created); mpr. DT 08.03.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA HNF-4 XX SY AF-1; hepatocyte nuclear factor 4; HNF4; NR2A1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G001926 HNF4A; HGNC: HNF4A. XX CL C0002; CC (rec). XX SZ 465 AA; 51.8 kDa (cDNA) (calc.). XX SQ MDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATG SQ KHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEA SQ VQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCE SQ SMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDY SQ IVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIK SQ RLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNL SQ LQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRPRGQAAT SQ PETPQPSPPGASGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI XX SC Swiss-Prot#P41235 XX FT 2 379 PF00478; IMP dehydrogenase / GMP reductase domai. FT 48 119 SM00399; c4gold. FT 48 123 PS51030; NUCLEAR_REC_DBD_2. FT 49 124 PF00105; Zinc finger, C4 type (two domains). FT 180 339 SM00430; holi. FT 183 364 PF00104; Ligand-binding domain of nuclear hormon. XX SF nuclear activity, may be composed of HNF-4alpha, HNF-4gamma; XX FF activates several intestine-specific promoters [5] [7]; FF activates liver-specific promoters [8] [4]; FF previously known as AF-1 binding to apolipoprotein promoters [4]; XX IN T02214 CBP-isoform1; human, Homo sapiens. XX MX M00158 V$COUP_01. MX M00762 V$DR1_Q3. MX M00638 V$HNF4ALPHA_Q6. MX M02220 V$HNF4A_03. MX M07321 V$HNF4A_Q3. MX M00764 V$HNF4DR1_Q3. MX M00134 V$HNF4_01. MX M00411 V$HNF4_01_B. MX M00967 V$HNF4_Q6. MX M01031 V$HNF4_Q6_01. MX M01032 V$HNF4_Q6_02. MX M01033 V$HNF4_Q6_03. MX M03828 V$HNF4_Q6_04. XX BS R01612. BS R16068. BS R20717. BS R08883. BS R19213. BS R15905. BS R15898. BS R13209. BS R15918. BS R15920. BS R16051. BS R15925. BS R15927. BS R15939. BS R15891. BS R16048. BS R15940. BS R15941. BS R13070. BS R12987. BS R03881. XX DR TRANSPATH: MO000026732. DR EMBL: X76930; DR UniProtKB: P41235; XX RN [1]; RE0000898. RX PUBMED: 2777781. RA Leff T., Reue K., Melian A., Culver H., Breslow J. L. RT A Regulatory Element in the ApoCIII Promoter That Directs Hepatic Specific Transcription Binds to Proteins in Expressing and Nonexpressing Cell Types RL J. Biol. Chem. 264:16132-16137 (1989). RN [2]; RE0002747. RX PUBMED: 2161847. RA Metzger S., Leff T., Breslow J. L. RT Nuclear factors AF-1 and C/EBP bind to the human ApoB gene promoter and modulate its transcriptional activity in hepatic cells RL J. Biol. Chem. 265:9978-9983 (1990). RN [3]; RE0006828. RX PUBMED: 7926813. RA Chartier F. L., Bossu J.-P., Laudet V., Fruchart J.-C., Laine B. RT Full sequence of the human HNF4 cDNA RL Gene 147:269-272 (1994). RN [4]; RE0007472. RX PUBMED: 8344962. RA Metzger S., Halaas J. L., Breslow J. L., Sladek F. M. RT Orphan Receptor HNF-4 and bZip protein C/EBPalpha bind to overlapping regions of the apolipoprotein B gene promoter and synergistically activate transcription RL J. Biol. Chem. 268:16831- 16838 (1993). RN [5]; RE0011477. RX PUBMED: 7650015. RA Bisaha J. G., Simon T. C., Gordon J. I., Breslow J. L. RT Characterization of an enhancer element in the human apolipoprotein C-III gene that regulates human apolipoprotein A-I gene expression in the intestinal epithelium RL J. Biol. Chem. 270:19979-19988 (1995). RN [6]; RE0013625. RX PUBMED: 10219237. RA Nuclear Receptors Nomenclature Committee. RT A unified nomenclature system for the nuclear receptor superfamily RL Cell 97:161-163 (1999). RN [7]; RE0014425. RX PUBMED: 10070050. RA Swenson E. S., Mann E. A., Jump M. L., Giannella R. A. RT Hepatocyte nuclear factor-4 regulates intestinal expression of the guanylin/heat-stable toxin receptor RL Am. J. Physiol. 276:G728-G736 (1999). RN [8]; RE0018060. RX PUBMED: 11574686. RA del Castillo-Olivares A., Gil G. RT Suppression of sterol 12alpha-hydroxylase transcription by the short heterodimer partner: insights into the repression mechanism. RL Nucleic Acids Res. 29:4035-4042 (2001). RN [9]; RE0016571. RX PUBMED: 8455618. RA Jackson D. A., Rowader K. E., Stevens K., Jiang C., Milos P., Zaret K. S. RT Modulation of liver-specific transcription by interaction between Hepatocyte Nuclear Factor 3 and Nuclear Factor 1 binding DNA in close apposition. RL Mol. Cell. Biol. 13:2401-2410 (1993). XX //