TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02917 XX ID T02917 XX DT 28.01.2000 (created); sur. DT 17.02.2005 (updated); vma. CO Copyright (C), QIAGEN. XX FA TCF-4B XX SY hTCF-4B; human TCF-4B; TCF7L2; transcription factor-7-like-2. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004017 TCF7L2; HGNC: TCF7L2. XX CL C0015; HMG. XX SZ 442 AA; 49.1 kDa (cDNA) (calc.). XX SQ MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS SQ DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS SQ LSPTARTYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPL SQ ITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQ SQ QGQPVYPITTGGFRHPYPTALTVNASVSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQES SQ SQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQI SQ LGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNGEKK SQ SAFATYKVKAAASAHPLQMEAY XX SC TREMBL #O00185; modified according to [2]; AA 410 Q instead of K [4] XX FT 1 53 N terminal interaction domain [2]. FT 326 396 SM00398; hmgende2. FT 327 400 HMG domain [2]. FT 327 395 PF00505; HMG (high mobility group) box. FT 327 395 PS50118; HMG_BOX_2. FT 402 442 identical to TCF-4B (mouse) AA 408-448 [4]. FT 417 442 B tail [5]. XX SF not expressed in cells of the lymphoid lineage [1]; SF pI 8.74; SF member of Wnt-signal transduction cascade [3]; SF RT-PCR assay for expression of TCF genes in colon tumor cells showed that only TCF-4 mRNA was expressed in all lines [2]; XX FF interaction of the N terminus of TCF-4 with beta-catenin results in transcriptional activation (of reporter genes) [2]; XX IN T02872 beta-catenin; human, Homo sapiens. XX MX M00671 V$TCF4_Q5. MX M04633 V$TCF4_Q5_02. XX DR TRANSPATH: MO000026881. DR EMBL: Y11306; XX RN [1]; RE0007924. RX PUBMED: 1741298. RA Castrop J., van Norren K., Clevers H. RT A gene family of HMG-box transcription factors with homology to TCF-1 RL Nucleic Acids Res. 20:611 (1992). RN [2]; RE0014030. RX PUBMED: 9065401. RA Korinek V., Barker N., Morin P. J., van Wichen D., de Weger R., Kinzler K. W., Vogelstein B., Clevers H. RT Constitutive transcriptional activation by a beta-catenin-Tcf complex in APC-/- colon carcinoma RL Science 275:1784-1787 (1997). RN [3]; RE0014033. RX PUBMED: 10489374. RA Roose J., Huls G., van Beest M., Moerer P., van der Horn K., Goldschmeding R., Logtenberg T., Clevers H. RT Synergy Between Tumor Suppressor APC and the beta-Catenin-Tcf4 Target Tcf1 RL Science 285:1923-1926 (1999). RN [4]; RE0014557. RX PUBMED: 9880534. RA Lee Y. J., Swencki B., Shoichet S., Shivdasani R. A. RT A possible role for the high mobility group box transcription factor Tcf-4 in vertebrate gut epithelial cell differentiation RL J. Biol. Chem. 274:1566-1572 (1999). RN [5]; RE0014765. RX PUBMED: 10756202. RA Hovanes K., Li T. W. H., Waterman M. L. RT The human LEF-1 gene contains a promoter preferentially active in lymphocytes and encodes multiple isoforms derived from alternative splicing RL Nucleic Acids Res. 28:1994-2003 (2000). XX //