TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T03598 XX ID T03598 XX DT 18.07.2000 (created); rio. CO Copyright (C), QIAGEN. XX FA HOXA1a XX OS zebra fish, Brachydanio rerio OC eukaryota; animalia; metazoa; chordata; vertebrata; osteichthyes; actinopterygii; cypriniformes; cyprinoidei; cyprinidae XX HO Lab (Drosophila) T02064. XX CL C0006; homeo. XX SZ 308 AA; 34.6 kDa (cDNA) (calc.). XX SQ MNSYLDYTIYNRGSNTYSSKVGCFPVEQEYLPSACASTNSYIPEGRPVGGNTFTSAPHET SQ HGTSYAQIQSQAFHLNVDMGKTGHSNFCKQTRPPHSDYGHQHVLTQADDHMRLQSPGFSV SQ VNMGANIGTYSESNCRPGSVSASHYQSYAYGEPEPHGCGSFSKYQVSPDSDSDSKTNIKQ SQ APTFDWMKVKRNPPKTVKVAEYGIHGQQNIIRTNFTTKQLTELEKEFHFNKYLTRARRVE SQ VAATLELNETQVKIWFQNRRMKQKKREKEGTAPVIKRVTLCSSGQNRRPLKLAHRLVPSP SQ TSDSSTAI XX SC translated from EMBL #U40995 XX FT 206 266 PS50071; HOMEOBOX_2. FT 208 270 SM00389; HOX_1. FT 209 265 PF00046; Homeobox domain. XX SF treatment with retinoic acid (RA) causes upregulation of HOXA1 [1]; SF overexpression causes abnormal development of the anterior hindbrain, duplication of Mauthner neurons in rhombomere 2 (r2) and fate changes of r2 mesenchymal and neurogenic neural crest [1]; SF probably early duplication events led to 7 HOX clusters in zebrafish instead of 4 in mammals, they were named Aa, Ab, Ba, Bb, Ca, Cb and D [2]; XX CP (gastrula stage:) shield at the dorsal surface, (tailbud stage:) stripe on the dorsal surface, (embryo 10-16h:) rhombomere 4, rhombomere 3/4 boundary [1]. XX FF involved in the control of anterior hindbrain patterning [1]; XX DR TRANSPATH: MO000027531. DR EMBL: U40995; DR UniProtKB: Q90423; XX RN [1]; RE0014844. RX PUBMED: 8631251. RA Alexandre D., Clarke J. D., Oxtoby E., Yan Y. L., Jowett T., Holder N. RT Ectopic expression of Hoxa-1 in the zebrafish alters the fate of the mandibular arch neural crest and phenocopies a retinoic acid-induced phenotype RL Development 122:735-746 (1996). RN [2]; RE0014862. RX PUBMED: 9831563. RA Amores A., Force A., Yan Y. L., Joly L., Amemiya C., Fritz A., Ho R. K., Langeland J., Prince V., Wang Y. L., Westerfield M., Ekker M., Postlethwait J. H. RT Zebrafish hox clusters and vertebrate genome evolution RL Science 282:1711-1714 (1998). XX //