TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02064 AS T22694. XX ID T02064 XX DT 28.01.1997 (created); ewi. DT 06.02.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Lab XX SY CG1264; F24; F90-2; Homeotic protein labial; labial. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX GE G009034 lab. XX HO HOXA1 (vert.) T01695,T01696,T01697,T03598. XX CL C0006; homeo. XX SZ 635 AA; 68.2 kDa (gene) (calc.). XX SQ MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQLQQQQQHQHLQ SQ QPQQHLTYNGYESSSPGNYYPQQQAQLTPPPTSSHQVVQQHQQQQQAQQQQLYPHSHLFS SQ PSAAEYGITTSTTTGNPGKPLHPSSHSPADSYYESDSVHSYYATAAVATVAPPSNSSPIT SQ AANASATSNTQQQQQQAAIISSENGMMYTNLDCMYPTAQAQAPVHGYAGQIEEKYAAVLH SQ ASYAPGMVLEDQDPMMQQATQSQMWHHQQHLAGSYALDAMDSLGMHAHMHHGLPHGHLGN SQ LANNPHQQQPQVQQQQQQPHQQPQHPQNQSPAAHQQHHQNSVSPNGGMNRQQRGGVISPG SQ SSTSSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPSYLPAPKLPASGI SQ ASMHDYQMNGQLDMCRGGGGGGSDVGSGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAG SQ SAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEI SQ ANTLQLNETQVKIWFQNRRMKQKKRVKEGLIPADILTQHSTSVISEKPPQQQQPQPPELQ SQ LKSQGSDLGGNELATGAPSTPTTAMTLTAPTSKQS XX SC Swiss-Prot#P10105-1 XX FT 194 588 PF00478; IMP dehydrogenase / GMP reductase domain. FT 505 565 PS50071; HOMEOBOX_2. FT 507 569 SM00389; HOX_1. FT 508 564 PF00046; Homeobox domain. XX FF important for endodermal development and required for development of some ectodermal structures (head) [6] [7]; FF expressed at low levels in midgut primordia [3]; FF large raising after fusion and concentrating in the nuclei of a distinct band in the newly formed midgut epithelium [4] [5]; XX MX M02348 I$LAB_01. MX M07803 I$LAB_02. XX BS R09578. BS R02507. XX DR TRANSPATH: MO000026133. DR UniProtKB: P10105-1; DR FLYBASE: FBgn0002522. XX RN [1]; RE0005129. RX PUBMED: 2461299. RA Mlodzik M., Fjose A., Gehring W. J. RT Molecular structure and spatial expression of a homeobox gene from the labial region of the antennapedia-complex RL EMBO J. 7:2569-2578 (1988). RN [2]; RE0005130. RX PUBMED: 3014511. RA Hoey T., Doyle H. J., Harding K., Wedeen C., Levine M. RT Homeo box gene expression in anterior and posterior regions of the Drosophila embryo RL Proc. Natl. Acad. Sci. USA 83:4809-4813 (1986). RN [3]; RE0005131. RX PUBMED: 2566560. RA Diederich R. J., Merrill V. K. L., Pultz M. A., Kaufman T. C. RT Isolation, structure, and expression of labial, a homeotic gene of the antennapedia complex involved in Drosophila head development RL Genes Dev. 3:399-414 (1989). RN [4]; RE0005375. RX PUBMED: 1973634. RA Immerglueck K., Lawrence P. A., Bienz M. RT Induction across germ layers in Drosophila mediated by a genetic cascade RL Cell 62:261-268 (1990). RN [5]; RE0005376. RX PUBMED: 1363088. RA Tremml G., Bienz M. RT Induction of labial expression in the Drosophila endoderm: response elements for dpp signalling and for autoregulation RL Development 116:447-456 (1992). RN [6]; RE0005377. RX PUBMED: 1687459. RA Chouinard S., Kaufman T. C. RT Control of expression of the homeotic labial (lab) locus of Drosophila melanogaster: evidence for both positive and negative autogenous regulation RL Development 113:1267-1280 (1991). RN [7]; RE0005378. RX PUBMED: 2570723. RA Merrill V. K., Diederich R. J., Turner F. R., Kaufman T. C. RT A genetic and developmental analysis of mutations in labial, a gene necessary for proper head formation in Drosophila melanogaster RL Dev. Biol. 135:376-391 (1989). RN [8]; RE0015328. RX PUBMED: 7902124. RA Kalionis B., O'Farrell P. H. RT A universal target sequence is bound in vitro by diverse homeodomains RL Mech. Dev. 43:57-70 (1993). XX //