TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04046 XX ID T04046 XX DT 30.11.2000 (created); rio. DT 01.08.2013 (updated); mkl. CO Copyright (C), QIAGEN. XX FA MOX1-isoform1 XX SY Mox-1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002119 MEOX1; HGNC: MEOX1. XX CL C0006; homeo. XX SZ 254 AA; 28.0 kDa (cDNA) (calc.). XX SQ MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYP SQ DFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSS SQ LGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTK SQ EQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQ SQ DPEDGDSTASPSSE XX SC translated from EMBL #U10492 XX FT 169 229 PS50071; HOMEOBOX_2. FT 171 233 SM00389; HOX_1. FT 172 228 PF00046; Homeobox domain. XX SF two splice variants Meox1/Meox1a T04050 [1]; SF linked to the BRCA1 T04074 chromosomal region [1]; SF 86% amino acid identity to murine Meox1T04047 [1]; XX EX brain,,,fetal-6; detectable; Northern blot; RNA (undefined); [1]. EX colon,,,adult; low; Northern blot; RNA (undefined); [1]. EX heart,,,fetal-6; high; Northern blot; RNA (undefined); [1]. EX human, Homo sapiens,leucocyte,,adult; high; Northern blot; RNA (undefined); [1]. EX kidney (right and left),,,fetal-6; detectable; Northern blot; RNA (undefined); [1]. EX liver,,,fetal-6; detectable; Northern blot; RNA (undefined); [1]. EX lung (right and left),,,fetal-6; detectable; Northern blot; RNA (undefined); [1]. EX ovary (right and left),,,adult; high; Northern blot; RNA (undefined); [1]. EX prostate gland,,,adult; medium; Northern blot; RNA (undefined); [1]. EX small intestine,,,adult; high; Northern blot; RNA (undefined); [1]. EX spleen,,,adult; very high; Northern blot; RNA (undefined); [1]. EX testis (right and left),,,adult; very low; Northern blot; RNA (undefined); [1]. EX thymus,,,adult; medium; Northern blot; RNA (undefined); [1]. XX MX M01443 V$MOX1_01. XX DR TRANSPATH: MO000027955. DR EMBL: U10492; DR UniProtKB: P50221-1; XX RN [1]; RE0015388. RX PUBMED: 7987315. RA Futreal P. A., Cochran C., Rosenthal J., Miki Y., Swenson J., Hobbs M., Bennett L. M., Haugen-Strano A., Marks J., Barrett J. C. RT Isolation of a diverged homeobox gene, MOX1, from the BRCA1 region on 17q21 by solution hybrid capture RL Hum. Mol. Genet. 3:1359-1364 (1994). XX //