TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04445 XX ID T04445 XX DT 23.04.2001 (created); rio. DT 03.01.2012 (updated); hna. CO Copyright (C), QIAGEN. XX FA Nkx5-2 XX SY H6 homeobox 2; HMX2; Nkx-5.2; NKX5-2. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002450 Hmx2. XX CL C0053; NK-2/Nkx. XX SZ 286 AA; 31.2 kDa (cDNA) (calc.). XX SQ LGRSWFPPISYEPRMAARKMWGRDVRRPVASPASPSSPSWAGALRGTAGARRVASQETQP SQ VCVLGGGGAGEGWKAPACFCPDPHGPKEPSPKHHTPIPFPCLGTPKGSGGAGPAASERTP SQ FLSPSHPDFKEEKERLLPAGSPSPGPERPRDGGAERQTGAAKKKTRTVFSRSQVYQLEST SQ FDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQTLVG SQ MPLVFRDSSLLRVPVPRSLAFPAPLYYPSSNLSALPLYNLYNKLDY XX SC translated from EMBL #S80989 XX FT 160 220 PS50071; HOMEOBOX_2. FT 162 224 SM00389; HOX_1. FT 163 219 PF00046; Homeobox domain. XX SF 92% amino acid identity to the homeo domain of Hmx3 T04446 [3]; SF Hmx2 and Hmx3 T04446 are clustered on chromosome 7 [3]; SF Hmx2 and Hmx3 T04446 have overlapping spatial expression patterns but the onset of Hmx3 transcription begins much earlier [1]; XX CP (adult:) uterus [2]. CN (E14.5:) thalamus [1]. EX dorsal premammillary nucleus,,,Theiler Stage 26; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX dorsomedial nucleus of dorsal hypothalamus,,,Theiler Stage 26; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX mammillary area,,,Theiler Stage 23; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX mesencephalon,,,Theiler Stage 23; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX myelencephalon,,,Theiler Stage 23; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX myelencephalon,,,Theiler Stage 26; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX neural crest of otocyst,,,Theiler Stage 17; none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX neural crest of otocyst,,,Theiler Stage 19; none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX pons,,,Theiler Stage 23; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX preoptic area,,,Theiler Stage 23; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX preoptic area,,,Theiler Stage 26; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX semicircular canals,,,Theiler Stage 23; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. EX subthalamus,,,Theiler Stage 23; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [1]. XX FF probably involved in cell type specification of neuronal cells [1]; XX MX M01315 V$NKX52_01. XX DR TRANSPATH: MO000028295. DR EMBL: S80989; DR UniProtKB: P43687; XX RN [1]; RE0016066. RX PUBMED: 8541222. RA Rinkwitz-Brandt S., Justus M., Oldenettel I., Arnold H. H., Bober E. RT Distinct temporal expression of mouse Nkx-5.1 and Nkx-5.2 homeobox genes during brain and ear development RL Mech. Dev. 52:371-381 (1995). RN [2]; RE0016068. RX PUBMED: 9435283. RA Wang W., Van De Water T., Lufkin T. RT Inner ear and maternal reproductive defects in mice lacking the Hmx3 homeobox gene RL Development 125:621-634 (1998). RN [3]; RE0016077. RX PUBMED: 7510254. RA Bober E., Baum C., Braun T., Arnold H. H. RT A novel NK-related mouse homeobox gene: expression in central and peripheral nervous structures during embryonic development RL Dev. Biol. 162:288-303 (1994). XX //