TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04452 XX ID T04452 XX DT 30.04.2001 (created); rio. CO Copyright (C), QIAGEN. XX FA Barx2b XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G001922 Barx2. XX HO BarH1T03926, BarH2T03927 (Drosophila). XX CL C0006; homeo. XX SZ 283 AA; 31.5 kDa (cDNA) (calc.). XX SQ MHCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHS SQ CTGSPSLRAYPLLSVITRQPTVISHLVPTGSGLTPVLTRHPVAAAEAAAAAAETPGGEAL SQ ASSESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQ SQ VKTWYQNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQSQELLES SQ SERQEEPCDTQEPKACLVPLEVAEPIHQPQELSEASSEPPPLS XX SC sequence taken from Ref. [1] XX FT 123 133 SRF interaction domain [1]. FT 135 195 PS50071; HOMEOBOX_2. FT 137 199 SM00389; HOX_1. FT 138 194 PF00046; Homeobox domain. XX SF 73% amino acid identity to chicken Barx2b T03925 [1]; SF interacts with SRF T00764 and increases the affinity of SRF for a CArG box binding site [1]; XX EX aorta,,,adult; high; RNAse protection assay; RNA (undefined); [1]. EX brain,,,adult; detectable; RNAse protection assay; RNA (undefined); [1]. EX heart,,,adult; none; Northern blot; total RNA; [1]. EX heart,,,adult; none; RNAse protection assay; RNA (undefined); [1]. EX ileum,,,adult; detectable; Northern blot; total RNA; [1]. EX ileum,,,adult; high; Northern blot; mRNA (poly-A); [1]. EX ileum,,,adult; high; RNAse protection assay; RNA (undefined); [1]. EX kidney (right and left),,,adult; none; RNAse protection assay; RNA (undefined); [1]. EX liver,,,adult; none; Northern blot; total RNA; [1]. EX liver,,,adult; none; RNAse protection assay; RNA (undefined); [1]. EX lung,,,adult; high; RNAse protection assay; RNA (undefined); [1]. EX muscles,,,adult; detectable; RNAse protection assay; RNA (undefined); [1]. EX spleen,,,adult; none; RNAse protection assay; RNA (undefined); [1]. EX stomach,,,adult; high; RNAse protection assay; RNA (undefined); [1]. EX urinary bladder,,,adult; detectable; Northern blot; mRNA (poly-A); [1]. EX urinary bladder,,,adult; none; Northern blot; total RNA; [1]. EX uterus,,,adult; high; Northern blot; mRNA (poly-A); [1]. EX uterus,,,adult; high; RNAse protection assay; RNA (undefined); [1]. XX FF Barx2b mRNA is expressed in high levels in several smooth muscle-containing tissue; XX IN T00764 SRF; human, Homo sapiens. XX MX M01431 V$BARX2_01. XX DR TRANSPATH: MO000028302. DR UniProtKB: O08686; XX RN [1]; RE0016089. RX PUBMED: 11278942. RA Herring B. P., Kriegel A. M., Hoggatt A. M. RT Identification of Barx2b, a serum response factor-associated homeodomain protein. RL J. Biol. Chem. 276:14482-14489 (2001). XX //