
AC   T04619
XX
ID   T04619
XX
DT   19.07.2001 (created); mas.
DT   15.04.2009 (updated); sva.
CO   Copyright (C), QIAGEN.
XX
FA   PXR-isoform2
XX
SY   NR1I2; pregnane X receptor; PXR.
XX
OS   mouse, Mus musculus
OC   eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE   G002752 Nr1i2.
XX
CL   C0002; CC (rec).
XX
SZ   390 AA; 45.0 kDa (cDNA) (calc.).
XX
SQ   MRPEESWSRVGLVQCEEADSALEEPINVEEEDGGLQICRVCGDKANGYHFNVMTCEGCKG
SQ   FFRRAMKRNVRLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRA
SQ   LIKRKKREKIEAPPPGGQGLTEEQQALIQELMDAQMQTFDTTFSHFKDFRLRGEDGSIWN
SQ   YQPPSKSDGKEIIPLLPHLADVSTYMFKGVINFAKVISYFRDLPIEDQISLLKGATFEMC
SQ   ILRFNTMFDTETGTWECGRLAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLHKEEYVLMQ
SQ   AISLFSPDRPGVVQRSVVDQLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSIN
SQ   AQQTQQLLRIQDSHPFATPLMQELFSSTDG
XX
SC   translated from [1] (Kliewer et al. 1988, Cell 92, pp. 73-82)
XX
FT        1    242    PF00478; IMP dehydrogenase / GMP reductase domai.
FT       35    107
   PF00478; IMP dehydrogenase / GMP reductase domai.
FT       35    107    SM00399; c4gold.
FT       35    111
   SM00399; c4gold.
FT       35    111    PS51030; NUCLEAR_REC_DBD_2.
FT       36    112
   PS51030; NUCLEAR_REC_DBD_2.
FT       36    112    PF00105; Zinc finger, C4 type (two domains).
FT       38    104
   PF00105; Zinc finger, C4 type (two domains).
FT       38    104    DNA-binding domain [1].
FT      138    390
   DNA-binding domain [1].
FT      138    390    putative ligand-binding domain [1].
FT      201    360
   putative ligand-binding domain [1].
FT      201    360    SM00430; holi.
FT      204    384
   SM00430; holi.
FT      204    384    PF00104; Ligand-binding domain of nuclear hormon.
   PF00104; Ligand-binding domain of nuclear hormon.
 XX
EX   adrenal gland (right + left),,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   brain,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   brain,,,adult; none; Northern blot; mRNA (poly-A);  [1].
EX   epithelial layer of gastrointestinal tract,,,Theiler Stage 26; high; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   heart,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   heart,,,adult; none; Northern blot; mRNA (poly-A);  [1].
EX   intestine,,,adult; high; Northern blot; mRNA (poly-A);  [1].
EX   kidney (right and left),,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   kidney (right and left),,,adult; low; Northern blot; mRNA (poly-A);  [1].
EX   liver,,,Theiler Stage 26; high; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   liver,,,adult; high; Northern blot; mRNA (poly-A);  [1].
EX   lung,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   lung,,,adult; none; Northern blot; mRNA (poly-A);  [1].
EX   muscles,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   muscles,,,adult; none; Northern blot; mRNA (poly-A);  [1].
EX   skin,,,adult; none; Northern blot; mRNA (poly-A);  [1].
EX   spinal cord,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   spleen,,,adult; none; Northern blot; mRNA (poly-A);  [1].
EX   stomach,,,adult; low; Northern blot; mRNA (poly-A);  [1].
EX   testis (right and left),,,adult; none; Northern blot; mRNA (poly-A);  [1].
EX   thymus,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   thymus,,,adult; none; Northern blot; mRNA (poly-A);  [1].
XX
FF   smaller range of activating ligands than isoform T04618 probably due to shorter ligand-binding domain [1];
FF   activating ligands: dexamethasone-t-butyl-acetate (artificial ligand), 5beta-3,20-dione (naturally occurring) [1];
XX
IN   T01345 RXR-alpha; human, Homo sapiens.
XX
MX   M00966 V$DR3_Q4.
MX   M00965 V$DR4_Q2.
MX   M07280 V$NR1NR2_Q3.
MX   M00964 V$PXR_Q2.
XX
DR   TRANSPATH: MO000028452.
DR   EMBL: AF031814;
DR   UniProtKB: O54915-2;
XX
RN   [1]; RE0016460.
RX   PUBMED: 9489701.
RA   Kliewer S. A., Moore J. T., Wade L., Staudinger J. L., Watson M. A., Jones S. A., McKee D. D., Oliver B. B., Willson T. M., Zetterstrom R. H., Perlmann T., Lehmann J. M.
RT   An orphan nuclear receptor activated by pregnanes defines a novel steroid signaling pathway
RL   Cell 92:73-82 (1998).
XX
//
XX
EX   adrenal gland (right + left),,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   brain,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   brain,,,adult; none; Northern blot; mRNA (poly-A);  [1].
EX   epithelial layer of gastrointestinal tract,,,Theiler Stage 26; high; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   heart,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   heart,,,adult; none; Northern blot; mRNA (poly-A);  [1].
EX   intestine,,,adult; high; Northern blot; mRNA (poly-A);  [1].
EX   kidney (right and left),,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   kidney (right and left),,,adult; low; Northern blot; mRNA (poly-A);  [1].
EX   liver,,,Theiler Stage 26; high; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   liver,,,adult; high; Northern blot; mRNA (poly-A);  [1].
EX   lung,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   lung,,,adult; none; Northern blot; mRNA (poly-A);  [1].
EX   muscles,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   muscles,,,adult; none; Northern blot; mRNA (poly-A);  [1].
EX   skin,,,adult; none; Northern blot; mRNA (poly-A);  [1].
EX   spinal cord,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   spleen,,,adult; none; Northern blot; mRNA (poly-A);  [1].
EX   stomach,,,adult; low; Northern blot; mRNA (poly-A);  [1].
EX   testis (right and left),,,adult; none; Northern blot; mRNA (poly-A);  [1].
EX   thymus,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined);  [1].
EX   thymus,,,adult; none; Northern blot; mRNA (poly-A);  [1].
XX
FF   smaller range of activating ligands than isoform T04618 probably due to shorter ligand-binding domain [1];
FF   activating ligands: dexamethasone-t-butyl-acetate (artificial ligand), 5beta-3,20-dione (naturally occurring) [1];
XX
IN   T01345 RXR-alpha; human, Homo sapiens.
XX
MX   M00966 V$DR3_Q4.
MX   M00965 V$DR4_Q2.
MX   M07280 V$NR1NR2_Q3.
MX   M00964 V$PXR_Q2.
XX
DR   TRANSPATH: MO000028452.
DR   EMBL: AF031814;
DR   UniProtKB: O54915-2;
XX
RN   [1]; RE0016460.
RX   PUBMED: 9489701.
RA   Kliewer S. A., Moore J. T., Wade L., Staudinger J. L., Watson M. A., Jones S. A., McKee D. D., Oliver B. B., Willson T. M., Zetterstrom R. H., Perlmann T., Lehmann J. M.
RT   An orphan nuclear receptor activated by pregnanes defines a novel steroid signaling pathway
RL   Cell 92:73-82 (1998).
XX
//