TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04619 XX ID T04619 XX DT 19.07.2001 (created); mas. DT 15.04.2009 (updated); sva. CO Copyright (C), QIAGEN. XX FA PXR-isoform2 XX SY NR1I2; pregnane X receptor; PXR. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002752 Nr1i2. XX CL C0002; CC (rec). XX SZ 390 AA; 45.0 kDa (cDNA) (calc.). XX SQ MRPEESWSRVGLVQCEEADSALEEPINVEEEDGGLQICRVCGDKANGYHFNVMTCEGCKG SQ FFRRAMKRNVRLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRA SQ LIKRKKREKIEAPPPGGQGLTEEQQALIQELMDAQMQTFDTTFSHFKDFRLRGEDGSIWN SQ YQPPSKSDGKEIIPLLPHLADVSTYMFKGVINFAKVISYFRDLPIEDQISLLKGATFEMC SQ ILRFNTMFDTETGTWECGRLAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLHKEEYVLMQ SQ AISLFSPDRPGVVQRSVVDQLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSIN SQ AQQTQQLLRIQDSHPFATPLMQELFSSTDG XX SC translated from [1] (Kliewer et al. 1988, Cell 92, pp. 73-82) XX FT 1 242 PF00478; IMP dehydrogenase / GMP reductase domai. FT 35 107 SM00399; c4gold. FT 35 111 PS51030; NUCLEAR_REC_DBD_2. FT 36 112 PF00105; Zinc finger, C4 type (two domains). FT 38 104 DNA-binding domain [1]. FT 138 390 putative ligand-binding domain [1]. FT 201 360 SM00430; holi. FT 204 384 PF00104; Ligand-binding domain of nuclear hormon. XX EX adrenal gland (right + left),,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined); [1]. EX brain,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined); [1]. EX brain,,,adult; none; Northern blot; mRNA (poly-A); [1]. EX epithelial layer of gastrointestinal tract,,,Theiler Stage 26; high; RNA-in situ hybridization (not further specified); RNA (undefined); [1]. EX heart,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined); [1]. EX heart,,,adult; none; Northern blot; mRNA (poly-A); [1]. EX intestine,,,adult; high; Northern blot; mRNA (poly-A); [1]. EX kidney (right and left),,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined); [1]. EX kidney (right and left),,,adult; low; Northern blot; mRNA (poly-A); [1]. EX liver,,,Theiler Stage 26; high; RNA-in situ hybridization (not further specified); RNA (undefined); [1]. EX liver,,,adult; high; Northern blot; mRNA (poly-A); [1]. EX lung,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined); [1]. EX lung,,,adult; none; Northern blot; mRNA (poly-A); [1]. EX muscles,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined); [1]. EX muscles,,,adult; none; Northern blot; mRNA (poly-A); [1]. EX skin,,,adult; none; Northern blot; mRNA (poly-A); [1]. EX spinal cord,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined); [1]. EX spleen,,,adult; none; Northern blot; mRNA (poly-A); [1]. EX stomach,,,adult; low; Northern blot; mRNA (poly-A); [1]. EX testis (right and left),,,adult; none; Northern blot; mRNA (poly-A); [1]. EX thymus,,,Theiler Stage 26; none; RNA-in situ hybridization (not further specified); RNA (undefined); [1]. EX thymus,,,adult; none; Northern blot; mRNA (poly-A); [1]. XX FF smaller range of activating ligands than isoform T04618 probably due to shorter ligand-binding domain [1]; FF activating ligands: dexamethasone-t-butyl-acetate (artificial ligand), 5beta-3,20-dione (naturally occurring) [1]; XX IN T01345 RXR-alpha; human, Homo sapiens. XX MX M00966 V$DR3_Q4. MX M00965 V$DR4_Q2. MX M07280 V$NR1NR2_Q3. MX M00964 V$PXR_Q2. XX DR TRANSPATH: MO000028452. DR EMBL: AF031814; DR UniProtKB: O54915-2; XX RN [1]; RE0016460. RX PUBMED: 9489701. RA Kliewer S. A., Moore J. T., Wade L., Staudinger J. L., Watson M. A., Jones S. A., McKee D. D., Oliver B. B., Willson T. M., Zetterstrom R. H., Perlmann T., Lehmann J. M. RT An orphan nuclear receptor activated by pregnanes defines a novel steroid signaling pathway RL Cell 92:73-82 (1998). XX //