AC T04645
AS T05254.
XX
ID T04645
XX
DT 31.07.2001 (created); mas.
DT 21.04.2011 (updated); pum.
CO Copyright (C), QIAGEN.
XX
FA ERR3-isoform1
XX
SY ERR gamma2; ERR3-2; ESRRG; estrogen receptor related protein 3; estrogen-related receptor gamma; NR3B3.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G002761 ESRRG; HGNC: ESRRG.
XX
CL C0002; CC (rec); 2.1.1.2.5.1.
XX
SZ 458 AA; 51.3 kDa (cDNA) (calc.).
XX
SQ MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGG
SQ SSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
SQ NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
SQ QACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
SQ LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
SQ LQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMK
SQ LEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
SQ LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
XX
SC translated from EMBL #AF094518
XX
FT 100 380 
PF00478; IMP dehydrogenase / GMP reductase domai.
FT 125 196 
SM00399; c4gold.
FT 125 200 
PS51030; NUCLEAR_REC_DBD_2.
FT 126 201 
PF00105; Zinc finger, C4 type (two domains).
FT 129 193 
DNA-binding domain [1].
FT 194 236 
hinge region (region D) [1].
FT 237 458 
ligand-binding domain [1].
FT 270 428 
SM00430; holi.
FT 273 453 
PF00104; Ligand-binding domain of nuclear hormon.
XX
SF 100% sequence identity to mouse ortholog T04644 [3];
XX
EX adrenal gland (right and left),,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX adrenal gland (right and left),,,adult; low; Northern blot; RNA (undefined); [1].
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; none; Northern blot; mRNA (poly-A); [2].
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [2].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; none; Northern blot; mRNA (poly-A); [2].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [2].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; none; Northern blot; mRNA (poly-A); [2].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [2].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; none; Northern blot; mRNA (poly-A); [2].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [2].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; none; Northern blot; mRNA (poly-A); [2].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [2].
EX bone marrow,,,adult; none; Northern blot; RNA (undefined); [1].
EX brain,,,adult; detectable; Northern blot; RNA (undefined); [1].
EX brain,,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX brain,,,adult; high; Northern blot; mRNA (poly-A); [2].
EX brain,,,adult; medium; RT-PCR; RNA (undefined); [2].
EX brain,,,fetal; detectable; RT-PCR; RNA (undefined); [1].
EX brain,,,fetal; detectable; RT-PCR; RNA (undefined); [2].
EX brain,,,fetal; high; RT-PCR; RNA (undefined); [2].
EX colon,,,adult; low; RT-PCR; RNA (undefined); [2].
EX colon,,,adult; none; Northern blot; mRNA (poly-A); [2].
EX heart,,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX heart,,,adult; high; Northern blot; mRNA (poly-A); [2].
EX heart,,,adult; low; Northern blot; RNA (undefined); [1].
EX heart,,,adult; medium; RT-PCR; RNA (undefined); [2].
EX heart,,,fetal; high; RT-PCR; RNA (undefined); [2].
EX heart,,,fetal; high; RT-PCR; RNA (undefined); [2].
EX kidney (right and left),,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX kidney (right and left),,,adult; high; Northern blot; mRNA (poly-A); [2].
EX kidney (right and left),,,adult; none; RT-PCR; RNA (undefined); [2].
EX kidney (right and left),,,fetal; detectable; RT-PCR; RNA (undefined); [2].
EX kidney (right and left),,,fetal; high; RT-PCR; RNA (undefined); [2].
EX liver,,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX liver,,,adult; none; Northern blot; mRNA (poly-A); [2].
EX liver,,,adult; none; RT-PCR; RNA (undefined); [2].
EX liver,,,fetal; detectable; RT-PCR; RNA (undefined); [1].
EX liver,,,fetal; detectable; RT-PCR; RNA (undefined); [2].
EX liver,,,fetal; none; RT-PCR; RNA (undefined); [2].
EX lung (right and left),,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX lung (right and left),,,adult; none; Northern blot; RNA (undefined); [1].
EX lung (right and left),,,adult; none; Northern blot; mRNA (poly-A); [2].
EX lung (right and left),,,adult; none; RT-PCR; RNA (undefined); [2].
EX lung (right and left),,,fetal; detectable; RT-PCR; RNA (undefined); [1].
EX lung (right and left),,,fetal; detectable; RT-PCR; RNA (undefined); [2].
EX lung (right and left),,,fetal; low; RT-PCR; RNA (undefined); [2].
EX mammary gland,,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX muscles,,,adult; detectable; Northern blot; RNA (undefined); [1].
EX muscles,,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX muscles,,,adult; high; Northern blot; mRNA (poly-A); [2].
EX muscles,,,adult; none; RT-PCR; RNA (undefined); [2].
EX muscles,,,fetal; detectable; RT-PCR; RNA (undefined); [2].
EX muscles,,,fetal; high; RT-PCR; RNA (undefined); [2].
EX ovary (right and left),,,adult; none; Northern blot; mRNA (poly-A); [2].
EX ovary (right and left),,,adult; none; RT-PCR; RNA (undefined); [2].
EX pancreas,,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX pancreas,,,adult; high; Northern blot; mRNA (poly-A); [2].
EX pancreas,,,adult; none; RT-PCR; RNA (undefined); [2].
EX placenta,,,adult; detectable; Northern blot; RNA (undefined); [1].
EX placenta,,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX placenta,,,adult; high; Northern blot; mRNA (poly-A); [2].
EX placenta,,,adult; high; RT-PCR; RNA (undefined); [2].
EX prostate gland,,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX prostate gland,,,adult; low; Northern blot; mRNA (poly-A); [2].
EX prostate gland,,,adult; none; Northern blot; RNA (undefined); [1].
EX prostate gland,,,adult; none; RT-PCR; RNA (undefined); [2].
EX retina,,,adult; high; RT-PCR; RNA (undefined); [2].
EX small intestine,,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX small intestine,,,adult; low; Northern blot; mRNA (poly-A); [2].
EX small intestine,,,adult; none; Northern blot; RNA (undefined); [1].
EX small intestine,,,adult; none; RT-PCR; RNA (undefined); [2].
EX spleen,,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX spleen,,,adult; low; Northern blot; mRNA (poly-A); [2].
EX spleen,,,adult; none; Northern blot; RNA (undefined); [1].
EX spleen,,,adult; none; RT-PCR; RNA (undefined); [2].
EX spleen,,,fetal; low; RT-PCR; RNA (undefined); [2].
EX spleen,,,fetal; none; RT-PCR; RNA (undefined); [2].
EX stomach,,,adult; detectable; Northern blot; RNA (undefined); [1].
EX testis (right and left),,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX testis (right and left),,,adult; low; Northern blot; mRNA (poly-A); [2].
EX testis (right and left),,,adult; none; Northern blot; RNA (undefined); [1].
EX testis (right and left),,,adult; none; RT-PCR; RNA (undefined); [2].
EX thymus,,,adult; none; Northern blot; RNA (undefined); [1].
EX thymus,,,adult; none; Northern blot; mRNA (poly-A); [2].
EX thymus,,,adult; none; RT-PCR; RNA (undefined); [1].
EX thymus,,,adult; none; RT-PCR; RNA (undefined); [2].
EX thymus,,,fetal; low; RT-PCR; RNA (undefined); [2].
EX thymus,,,fetal; none; RT-PCR; RNA (undefined); [2].
EX thyroid gland,,,adult; detectable; RT-PCR; RNA (undefined); [1].
EX thyroid gland,,,adult; low; Northern blot; RNA (undefined); [1].
EX uterus,,,adult; none; RT-PCR; RNA (undefined); [1].
XX
DR TRANSPATH: MO000033863.
DR EMBL: AF094518; AF094518.
DR UniProtKB: P62508-1;
XX
RN [1]; RE0016527.
RX PUBMED: 10072763.
RA Chen F., Zhang Q., McDonald T., Davidoff M. J., Bailey W., Bai C., Liu Q., Caskey C. T.
RT Identification of two hERR2-related novel nuclear receptors utilizing bioinformatics and inverse PCR
RL Gene 228:101-109 (1999).
RN [2]; RE0016531.
RX PUBMED: 10707956.
RA Heard D. J., Norby P. L., Holloway J., Vissing H.
RT Human ERRgamma, a third member of the estrogen receptor-related receptor (ERR) subfamily of orphan nuclear receptors: tissue-specific isoforms are expressed during development and in the adult
RL Mol. Endocrinol. 14:382-392 (2000).
RN [3]; RE0016532.
RX PUBMED: 10631096.
RA Susens U., Hermans-Borgmeyer I., Borgmeyer U.
RT Alternative splicing and expression of the mouse estrogen receptor-related receptor gamma
RL Biochem. Biophys. Res. Commun. 267:532-535 (2000).
RN [4]; RE0069929.
RX PUBMED: 18063693.
RA Tremblay A. M., Wilson B. J., Yang X. J., Giguere V.
RT Phosphorylation-dependent sumoylation regulates estrogen-related receptor-alpha and -gamma transcriptional activity through a synergy control motif.
RL Mol. Endocrinol. 22:570-584 (2008).
XX
//