
AC T04644
XX
ID T04644
XX
DT 31.07.2001 (created); mas.
DT 13.01.2010 (updated); jig.
CO Copyright (C), QIAGEN.
XX
FA ERR3-isoform1
XX
SY ERR gamma2; ERR3-2; ESRRG; estrogen receptor related protein 3; estrogen-related receptor gamma; NR3B3.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G002760 Esrrg.
XX
CL C0002; CC (rec); 2.1.1.2.5.1.
XX
SZ 458 AA; 51.3 kDa (cDNA) (calc.).
XX
SQ MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGG
SQ SSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
SQ NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
SQ QACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
SQ LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
SQ LQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMK
SQ LEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
SQ LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
XX
SC translated from EMBL #AF117254
XX
FT 100 380
PF00478; IMP dehydrogenase / GMP reductase domai.
FT 125 196
SM00399; c4gold.
FT 125 200
PS51030; NUCLEAR_REC_DBD_2.
FT 126 201
PF00105; Zinc finger, C4 type (two domains).
FT 270 428
SM00430; holi.
FT 273 453
PF00104; Ligand-binding domain of nuclear hormon.
FT 448 458
AF-2 domain (activation function) [1].
XX
SF absolute sequence identity to human ortholog T04645 [3];
SF mutations in AF-2 domain of either pos. 449,450 or 453,454 (all hydrophobic residues) dramatically decrease transcriptional activation activity and interaction with TIF2 T02482 [1];
XX
CP (embryo:) expressed at E11, E15 and E17 [1] [3], and E12.5 (high levels in nervous system, in situ) [3]; (adult:) high levels in heart, brain, moderate levels in kidney [1] [3]; probably low levels in liver [1] or skeletal muscle [3] (contradictory data) [1] [3].
EX brain,,,adult; detectable; Northern blot; RNA (undefined); [3].
EX brain,,,adult; detectable; Northern blot; RNA (undefined); [4].
EX brain,,,adult; high; Northern blot; RNA (undefined); [1].
EX brain,,,adult; high; Northern blot; RNA (undefined); [3].
EX facial mesenchyme,,,Theiler Stage 21; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3].
EX heart,,,adult; detectable; Northern blot; RNA (undefined); [3].
EX heart,,,adult; high; Northern blot; RNA (undefined); [1].
EX heart,,,adult; high; Northern blot; RNA (undefined); [1].
EX heart,,,adult; high; Northern blot; RNA (undefined); [3].
EX heart,,,adult; none; Northern blot; RNA (undefined); [4].
EX hindgut,,,Theiler Stage 21; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3].
EX kidney (right and left),,,adult; detectable; Northern blot; RNA (undefined); [3].
EX kidney (right and left),,,adult; detectable; Northern blot; RNA (undefined); [4].
EX kidney (right and left),,,adult; high; Northern blot; RNA (undefined); [1].
EX kidney (right and left),,,adult; medium; Northern blot; RNA (undefined); [3].
EX limbs,,,Theiler Stage 21; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3].
EX liver,,,adult; low; Northern blot; RNA (undefined); [1].
EX liver,,,adult; none; Northern blot; RNA (undefined); [3].
EX liver,,,adult; none; Northern blot; RNA (undefined); [4].
EX lung,,,adult; detectable; Northern blot; RNA (undefined); [4].
EX lung,,,adult; none; Northern blot; RNA (undefined); [1].
EX lung,,,adult; none; Northern blot; RNA (undefined); [3].
EX mesencephalon,,,Theiler Stage 21; high; RNA-in situ hybridization (not further specified); RNA (undefined); [3].
EX midgut,,,Theiler Stage 21; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3].
EX mouse, Mus musculus,,,Theiler Stage 10; none; Northern blot; RNA (undefined); [1].
EX mouse, Mus musculus,,,Theiler Stage 10; none; Northern blot; RNA (undefined); [3].
EX mouse, Mus musculus,,,Theiler Stage 18; detectable; Northern blot; RNA (undefined); [3].
EX mouse, Mus musculus,,,Theiler Stage 18; detectable; Northern blot; RNA (undefined); [3].
EX mouse, Mus musculus,,,Theiler Stage 18; high; Northern blot; RNA (undefined); [1].
EX mouse, Mus musculus,,,Theiler Stage 21; high; Northern blot; RNA (undefined); [3].
EX mouse, Mus musculus,,,Theiler Stage 21; high; RNA-in situ hybridization (not further specified); RNA (undefined); [3].
EX mouse, Mus musculus,,,Theiler Stage 23; detectable; Northern blot; RNA (undefined); [3].
EX mouse, Mus musculus,,,Theiler Stage 23; high; Northern blot; RNA (undefined); [1].
EX mouse, Mus musculus,,,Theiler Stage 25; detectable; Northern blot; RNA (undefined); [3].
EX mouse, Mus musculus,,,Theiler Stage 25; low; Northern blot; RNA (undefined); [1].
EX muscles,,,adult; detectable; Northern blot; RNA (undefined); [3].
EX muscles,,,adult; none; Northern blot; RNA (undefined); [1].
EX muscles,,,adult; none; Northern blot; RNA (undefined); [4].
EX spleen,,,adult; detectable; Northern blot; RNA (undefined); [4].
EX spleen,,,adult; none; Northern blot; RNA (undefined); [1].
EX spleen,,,adult; none; Northern blot; RNA (undefined); [3].
EX stomach,,,Theiler Stage 21; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3].
EX testis (right and left),,,adult; detectable; Northern blot; RNA (undefined); [4].
EX testis (right and left),,,adult; none; Northern blot; RNA (undefined); [1].
EX testis (right and left),,,adult; none; Northern blot; RNA (undefined); [3].
XX
FF in contrast to other nuclear factors interaction with TIF2 T02482 in a ligand-independent way [1];
FF TIF2 T02482 functions as transcriptional coactivator [1];
XX
IN T04632 SRC-1; human, Homo sapiens.
IN T04640 SRC3; human, Homo sapiens.
IN T02482 TIF2; mouse, Mus musculus.
XX
DR TRANSPATH: MO000028477.
DR EMBL: AF117254;
DR UniProtKB: P62509-1; R3_MOUSE.
XX
RN [1]; RE0016449.
RX PUBMED: 10428842.
RA Hong H., Yang L., Stallcup M. R.
RT Hormone-independent transcriptional activation and coactivator binding by novel orphan nuclear receptor ERR3
RL J. Biol. Chem. 274:22618-22626 (1999).
RN [2]; RE0016527.
RX PUBMED: 10072763.
RA Chen F., Zhang Q., McDonald T., Davidoff M. J., Bailey W., Bai C., Liu Q., Caskey C. T.
RT Identification of two hERR2-related novel nuclear receptors utilizing bioinformatics and inverse PCR
RL Gene 228:101-109 (1999).
RN [3]; RE0016532.
RX PUBMED: 10631096.
RA Susens U., Hermans-Borgmeyer I., Borgmeyer U.
RT Alternative splicing and expression of the mouse estrogen receptor-related receptor gamma
RL Biochem. Biophys. Res. Commun. 267:532-535 (2000).
RN [4]; RE0016530.
RX PUBMED: 9676434.
RA Eudy J. D., Yao S., Weston M. D., Ma-Edmonds M., Talmadge C. B., Cheng J. J., Kimberling W. J., Sumegi J.
RT Isolation of a gene encoding a novel member of the nuclear receptor superfamily from the critical region of Usher syndrome type IIa at 1q41
RL Genomics 50:382-384 (1998).
XX
//