TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04647 XX ID T04647 XX DT 01.08.2001 (created); mas. DT 13.01.2010 (updated); jig. CO Copyright (C), QIAGEN. XX FA ERR3-isoform2 XX SY ERR gamma1; ESRRG; estrogen receptor related protein 3; estrogen-related receptor gamma; NR3B3. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002760 Esrrg. XX CL C0002; CC (rec). XX SZ 435 AA; 48.6 kDa (cDNA) (calc.). XX SQ MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPP SQ LYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVA SQ SCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRV SQ RGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIK SQ ALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDE SQ LVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIE SQ DVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGK SQ VPMHKLFLEMLEAKV XX SC translated from EMBL #AF117254 and modified according to [2] XX FT 77 357 PF00478; IMP dehydrogenase / GMP reductase domai. FT 102 173 SM00399; c4gold. FT 102 177 PS51030; NUCLEAR_REC_DBD_2. FT 103 178 PF00105; Zinc finger, C4 type (two domains). FT 247 405 SM00430; holi. FT 250 430 PF00104; Ligand-binding domain of nuclear hormon. FT 425 435 AF-2 domain (activation function) [1]. XX SF mutation of AF2- domain causes elimination of transactivation activity and no interaction with TIF2 T02482 [1]; XX CP (embryo:) expressed at E11, E15 and E17 [1] [2] and E12.5 (high levels in nervous system, in situ) [2]; (adult:) high levels in heart, brain, moderate levels in kidney [1] [2]; probably low levels in liver [1] or skeletal muscle [2] (contradictory data) [1] [2]. EX brain,,,adult; detectable; Northern blot; RNA (undefined); [3]. EX heart,,,adult; none; Northern blot; RNA (undefined); [3]. EX kidney (right and left),,,adult; detectable; Northern blot; RNA (undefined); [3]. EX liver,,,adult; none; Northern blot; RNA (undefined); [3]. EX lung,,,adult; detectable; Northern blot; RNA (undefined); [3]. EX muscles,,,adult; none; Northern blot; RNA (undefined); [3]. EX spleen,,,adult; detectable; Northern blot; RNA (undefined); [3]. EX testis (right and left),,,adult; detectable; Northern blot; RNA (undefined); [3]. XX FF in contrast to other nuclear factors interaction with TIF2 T02482 in a ligand-independent way [1]; XX IN T02482 TIF2; mouse, Mus musculus. XX DR TRANSPATH: MO000028480. DR EMBL: AF117254; DR UniProtKB: P62509-2; XX RN [1]; RE0016449. RX PUBMED: 10428842. RA Hong H., Yang L., Stallcup M. R. RT Hormone-independent transcriptional activation and coactivator binding by novel orphan nuclear receptor ERR3 RL J. Biol. Chem. 274:22618-22626 (1999). RN [2]; RE0016532. RX PUBMED: 10631096. RA Susens U., Hermans-Borgmeyer I., Borgmeyer U. RT Alternative splicing and expression of the mouse estrogen receptor-related receptor gamma RL Biochem. Biophys. Res. Commun. 267:532-535 (2000). RN [3]; RE0016530. RX PUBMED: 9676434. RA Eudy J. D., Yao S., Weston M. D., Ma-Edmonds M., Talmadge C. B., Cheng J. J., Kimberling W. J., Sumegi J. RT Isolation of a gene encoding a novel member of the nuclear receptor superfamily from the critical region of Usher syndrome type IIa at 1q41 RL Genomics 50:382-384 (1998). XX //