AC T04651
AS T05387.
XX
ID T04651
XX
DT 08.08.2001 (created); mas.
DT 05.05.2011 (updated); mka.
CO Copyright (C), QIAGEN.
XX
FA ER-beta-isoform1
XX
SY ER-beta1; ESR2; ESTRB; estrogen receptor beta; NR3A2.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G002764 ESR2; HGNC: ESR2.
XX
CL C0002; CC (rec); 2.1.1.2.2.1.
XX
SZ 530 AA; 59.2 kDa (cDNA) (calc.).
XX
SQ MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
SQ NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
SQ RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
SQ NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
SQ CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
SQ LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
SQ VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
SQ DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK
SQ CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ
XX
SC translated from EMBL #AB006590
XX
FT 1 148 
region A/B [1].
FT 102 106 
MAPK phosphorylation site (at Serin) [2].
FT 146 217 
SM00399; c4gold.
FT 146 221 
PS51030; NUCLEAR_REC_DBD_2.
FT 147 222 
PF00105; Zinc finger, C4 type (two domains).
FT 176 475 
PF00478; IMP dehydrogenase / GMP reductase domai.
FT 214 247 
region D [1].
FT 248 530 
region E/F, with ligand binding domain [1].
FT 300 469 
SM00430; holi.
FT 303 494 
PF00104; Ligand-binding domain of nuclear hormon.
FT 501 530 region F [2].
XX
SF can bind DNA as a homodimer or as a heterodimer T05702 with ER-alpha T00261 [4];
XX
CP (adult:) expressed in thymus, testis, ovary [2]; weak levels in spleen [2] [2].
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; RNA (undefined); [2].
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [7].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; RNA (undefined); [2].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [7].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; RNA (undefined); [2].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [7].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; RNA (undefined); [2].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [7].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; RNA (undefined); [2].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; none; RT-PCR; RNA (undefined); [7].
EX bone marrow,,,adult; low; RT-PCR; RNA (undefined); [7].
EX brain,,,adult; low; RT-PCR; RNA (undefined); [7].
EX colon,,,adult; low; RT-PCR; RNA (undefined); [7].
EX fatty layer of subcutaneous tissue,,,adult; low; RT-PCR; RNA (undefined); [7].
EX heart,,,adult; low; RT-PCR; RNA (undefined); [7].
EX kidney (right and left),,,adult; none; RT-PCR; RNA (undefined); [7].
EX liver,,,adult; low; RT-PCR; RNA (undefined); [7].
EX lung (right and left),,,adult; none; RT-PCR; RNA (undefined); [7].
EX mammary gland,,,adult; low; RT-PCR; RNA (undefined); [7].
EX muscles,,,adult; low; RT-PCR; RNA (undefined); [7].
EX ovary (right and left),,,adult; detectable; Northern blot; RNA (undefined); [1].
EX ovary (right and left),,,adult; detectable; Northern blot; RNA (undefined); [2].
EX ovary (right and left),,,adult; detectable; RT-PCR; mRNA (poly-A); [1].
EX ovary (right and left),,,adult; high; RT-PCR; RNA (undefined); [7].
EX ovary (right and left),,,adult; high; RT-PCR; RNA (undefined); [7].
EX pancreas,,,adult; none; RT-PCR; RNA (undefined); [7].
EX placenta,,,adult; low; RT-PCR; RNA (undefined); [7].
EX prostate gland,,,adult; low; RT-PCR; RNA (undefined); [7].
EX small intestine,,,adult; none; RT-PCR; RNA (undefined); [7].
EX spleen,,,adult; low; RT-PCR; RNA (undefined); [7].
EX spleen,,,adult; very low; Northern blot; RNA (undefined); [2].
EX testis (right and left),,,adult; detectable; Northern blot; RNA (undefined); [1].
EX testis (right and left),,,adult; detectable; Northern blot; RNA (undefined); [2].
EX testis (right and left),,,adult; detectable; RT-PCR; mRNA (poly-A); [1].
EX testis (right and left),,,adult; high; RT-PCR; RNA (undefined); [7].
EX testis (right and left),,,adult; high; RT-PCR; RNA (undefined); [7].
EX thymus,,,adult; detectable; Northern blot; RNA (undefined); [2].
EX thymus,,,adult; low; RT-PCR; RNA (undefined); [7].
EX uterus,,,adult; low; RT-PCR; RNA (undefined); [7].
XX
FF agonist: estradiol [2];
XX
IN T00261 ER-alpha; human, Homo sapiens.
IN T04651 ER-beta-isoform1; human, Homo sapiens.
XX
MX M00959 V$ER_Q6_02.
XX
BS R14257.
BS R01581.
BS R14226.
BS R14291.
BS R14203.
BS R35118.
BS R14194.
BS R14292.
BS R14228.
BS R14197.
BS R10107.
BS R10108.
XX
DR TRANSPATH: MO000021571.
DR EMBL: AB006590; AB006590.
DR UniProtKB: Q92731-1;
XX
RN [1]; RE0016538.
RX PUBMED: 9473491.
RA Ogawa S., Inoue S., Watanabe T., Hiroi H., Orimo A., Hosoi T., Ouchi Y., Muramatsu M.
RT The complete primary structure of human estrogen receptor beta (hER beta) and its heterodimerization with ER alpha in vivo and in vitro
RL Biochem. Biophys. Res. Commun. 243:122-126 (1998).
RN [2]; RE0016540.
RX PUBMED: 8769313.
RA Mosselman S., Polman J., Dijkema R.
RT ER beta: identification and characterization of a novel human estrogen receptor
RL FEBS Lett. 392:49-53 (1996).
RN [3]; RE0020843.
RX PUBMED: 11032808.
RA Migliaccio A., Castoria G., Di Domenico M., de Falco A., Bilancio A., Lombardi M., Barone M. V., Ametrano D., Zannini M. S., Abbondanza C., Auricchio F.
RT Steroid-induced androgen receptor-oestradiol receptor beta-Src complex triggers prostate cancer cell proliferation
RL EMBO J. 19:5406-5417 (2000).
RN [4]; RE0023363.
RX PUBMED: 9242648.
RA Cowley S. M., Hoare S., Mosselman S., Parker M. G.
RT Estrogen receptors alpha and beta form heterodimers on DNA.
RL J. Biol. Chem. 272:19858-19862 (1997).
RN [5]; RE0047608.
RX PUBMED: 16061639.
RA Perry WL 3. r. d., Shepard R. L., Sampath J., Yaden B., Chin W. W., Iversen P. W., Jin S., Lesoon A., O'Brien K. A., Peek V. L., Rolfe M., Shyjan A., Tighe M., Williamson M., Krishnan V., Moore R. E., Dantzig A. H.
RT Human splicing factor SPF45 (RBM17) confers broad multidrug resistance to anticancer drugs when overexpressed--a phenotype partially reversed by selective estrogen receptor modulators.
RL Cancer Res. 65:6593-6600 (2005).
RN [6]; RE0047675.
RX PUBMED: 15886699.
RA Wada-Hiraike O., Yano T., Nei T., Matsumoto Y., Nagasaka K., Takizawa S., Oishi H., Arimoto T., Nakagawa S., Yasugi T., Kato S., Taketani Y.
RT The DNA mismatch repair gene hMSH2 is a potent coactivator of oestrogen receptor alpha.
RL Br. J. Cancer 92:2286-2291 (2005).
RN [7]; RE0022247.
RX PUBMED: 9636657.
RA Moore J. T., McKee D. D., Slentz-Kesler K., Moore L. B., Jones S. A., Horne E. L., Su J. L., Kliewer S. A., Lehmann J. M., Willson T. M.
RT Cloning and characterization of human estrogen receptor beta isoforms.
RL Biochem. Biophys. Res. Commun. 247:75-78 (1998).
XX
//