TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04798 XX ID T04798 XX DT 20.09.2001 (created); mas. CO Copyright (C), QIAGEN. XX FA Bach1t XX SY BTB and CNC homolog 1; transcription regulator protein BACH1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002726 BACH1; HGNC: BACH1. XX CL C0008; bZIP. XX SZ 623 AA; 69.8 kDa (calc.). XX SQ MSLSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFH SQ SRIVGQADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEE SQ SCFQFLKFKFLDSTADQQECPRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQ SQ TPQCKLRRYQGNAKASPPLQDSASQTYESMCLEKDAALALPSLCPKYRKFQKAFGTDRVR SQ TGESSVKDIHASVQPNERSENECLGGVPECRDLQVMLKCDESKLAMEPEETKKDPASQCP SQ TEKSEVTPFPHNSSIDPHGLYSLSLLHTYDQYGDLNFAGMQNTTVLTEKPLSGTDVQEKT SQ FGESQDLPLKSDLGTREDSSVASSDRSSVEREVAEHLAKGFWSDICSTDTPCQMQLSPAV SQ AKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGN SQ DDYVSEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSRND SQ FQSLLKMHKLTPEQLDCIHDIRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLGSVENLMC SQ QEVFHTILRTLDTCSDSSVSAKQ XX SC translated from EMBL #AF124731 and modified according to [1] (from pos. 593 onwards) XX FT 16 122 BTB domain [2]. FT 24 130 PF00651; BTB/POZ domain. FT 34 100 PS50097; BTB. FT 34 130 SM00225; BTB_4. FT 553 619 SM00338; brlzneu. FT 558 609 PF00170; bZIP transcription factor. FT 562 578 truncated remainder of leucine zipper [1]. FT 562 592 PS50217; BZIP. FT 579 592 basic portion of bZIP [1]. XX SF isoform of T04791 without complete bZIP domain (basic region still present but leucine zipper truncated) [1]; XX EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; low; RT-PCR; RNA (undefined); [1]. EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; low; RT-PCR; RNA (undefined); [1]. EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; low; RT-PCR; RNA (undefined); [1]. EX blood,monocyte,Circulatory System & Hematopoietic System,adult; low; RT-PCR; RNA (undefined); [1]. EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; low; RT-PCR; RNA (undefined); [1]. EX colon,,,adult; medium; RT-PCR; RNA (undefined); [1]. EX ovary (right and left),,,adult; medium; RT-PCR; RNA (undefined); [1]. EX prostate gland,,,adult; medium; RT-PCR; RNA (undefined); [1]. EX small intestine,,,adult; low; RT-PCR; RNA (undefined); [1]. EX spleen,,,adult; medium; RT-PCR; RNA (undefined); [1]. EX testis (right and left),,,adult; very high; RT-PCR; RNA (undefined); [1]. EX thymus,,,adult; low; RT-PCR; RNA (undefined); [1]. XX FF in contrast to longer isoform T04791 no binding to beta-globin gene binding site R01946 (both in the absence and in the presence of heterodimer partner MafK of longer isoform) [1]; FF seems to have no DNA-binding activity at all [1]; FF interacts with Bach1/MafK heterodimer through BTB domain [1]; FF can mediate nuclear import of its longer isoform T04791 [1]; XX IN T04791 Bach1; human, Homo sapiens. XX MX M00495 V$BACH1_01. MX M07374 V$BACH1_Q3. MX M07296 V$MAF_Q4. MX M00983 V$MAF_Q6_01. XX DR TRANSPATH: MO000028608. DR EMBL: AF124731; DR UniProtKB: O14867; XX RN [1]; RE0016918. RX PUBMED: 11069897. RA Kanezaki R., Toki T., Yokoyama M., Yomogida K., Sugiyama K., Yamamoto M., Igarashi K., Ito E. RT Transcription factor BACH1 is recruited to the nucleus by its novel alternative spliced isoform RL J. Biol. Chem. 276:7278-7284 (2001). RN [2]; RE0016919. RX PUBMED: 9544839. RA Blouin J. L., Duriaux Sail G., Guipponi M., Rossier C., Pappasavas M. P., Antonarakis S. E. RT Isolation of the human BACH1 transcription regulator gene, which maps to chromosome 21q22.1 RL Hum. Genet. 102:282-288 (1998). XX //