AC T04791
XX
ID T04791
XX
DT 19.09.2001 (created); mas.
DT 08.04.2011 (updated); pro.
CO Copyright (C), QIAGEN.
XX
FA Bach1
XX
SY BTB and CNC homolog 1; transcription regulator protein BACH1.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G002726 BACH1; HGNC: BACH1.
XX
CL C0008; bZIP.
XX
SZ 736 AA; 82.0 kDa (cDNA) (calc.).
XX
SQ MSLSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFH
SQ SRIVGQADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEE
SQ SCFQFLKFKFLDSTADQQECPRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQ
SQ TPQCKLRRYQGNAKASPPLQDSASQTYESMCLEKDAALALPSLCPKYRKFQKAFGTDRVR
SQ TGESSVKDIHASVQPNERSENECLGGVPECRDLQVMLKCDESKLAMEPEETKKDPASQCP
SQ TEKSEVTPFPHNSSIDPHGLYSLSLLHTYDQYGDLNFAGMQNTTVLTEKPLSGTDVQEKT
SQ FGESQDLPLKSDLGTREDSSVASSDRSSVEREVAEHLAKGFWSDICSTDTPCQMQLSPAV
SQ AKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGN
SQ DDYVSEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSRND
SQ FQSLLKMHKLTPEQLDCIHDIRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLQSEKESLL
SQ KERDHILSTLGETKQNLTGLCQKVCKEAALSQEQIQILAKYSAADCPLSFLISEKDKSTP
SQ DGELALPSIFSLSDRPPAVLPPCARGNSEPGYARGQESQQMSTATSEQAGPAEQCRQSGG
SQ ISDFCQQMTDKCTTDE
XX
SC translated from EMBL #AB002803
XX
FT 16 122 BTB domain [3].
FT 24 130 PF00651; BTB/POZ domain.
FT 34 100 PS50097; BTB.
FT 34 130 SM00225; BTB_4.
FT 359 721 PF00478; IMP dehydrogenase / GMP reductase domain.
FT 553 619 SM00338; brlzneu.
FT 558 619 PF00170; bZIP transcription factor.
FT 562 577 basic portion of bZIP [3].
FT 562 624 basic leucine zipper (CNC bZIP region) [3].
FT 562 620 PS50217; BZIP.
FT 578 624 leucine zipper of bZIP [3].
XX
SF conflict in protein sequence between EMBL entries #AB002803 and #AF026199: pos. 158 (S versus T), pos. 171 (E versus G);
SF 88% identity to mouse homolog T04793 [3];
SF contains a BTB (Broad complex-Tramtrack-Bric-a-brac) domain and a CNC (Cap'n'collar) domain [3];
SF an isoform seems to exist which is only expressed in testis [1] [3];
XX
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; RNA (undefined); [2].
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; RNA (undefined); [2].
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; mRNA (poly-A); [3].
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; very low; RT-PCR; RNA (undefined); [2].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; RNA (undefined); [2].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; RNA (undefined); [2].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; mRNA (poly-A); [3].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; very low; RT-PCR; RNA (undefined); [2].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; RNA (undefined); [2].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; RNA (undefined); [2].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; mRNA (poly-A); [3].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; very low; RT-PCR; RNA (undefined); [2].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; RNA (undefined); [2].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; RNA (undefined); [2].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; mRNA (poly-A); [3].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; very low; RT-PCR; RNA (undefined); [2].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; RNA (undefined); [2].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; RNA (undefined); [2].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; very high; Northern blot; mRNA (poly-A); [3].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; very low; RT-PCR; RNA (undefined); [2].
EX brain,,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX brain,,,adult; medium; Northern blot; mRNA (poly-A); [3].
EX brain,,,adult; very low; Northern blot; RNA (undefined); [2].
EX brain,,,adult; very low; Northern blot; RNA (undefined); [2].
EX brain,,,fetal; detectable; Northern blot; mRNA (poly-A); [1].
EX brain,,,fetal; low; Northern blot; mRNA (poly-A); [3].
EX colon,,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX colon,,,adult; low; Northern blot; RNA (undefined); [2].
EX colon,,,adult; medium; Northern blot; RNA (undefined); [2].
EX colon,,,adult; medium; Northern blot; mRNA (poly-A); [3].
EX colon,,,adult; very low; RT-PCR; RNA (undefined); [2].
EX heart,,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX heart,,,adult; high; Northern blot; mRNA (poly-A); [3].
EX heart,,,adult; very low; Northern blot; RNA (undefined); [2].
EX heart,,,adult; very low; Northern blot; RNA (undefined); [2].
EX kidney (right and left),,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX kidney (right and left),,,adult; low; Northern blot; RNA (undefined); [2].
EX kidney (right and left),,,adult; low; Northern blot; RNA (undefined); [2].
EX kidney (right and left),,,adult; medium; Northern blot; mRNA (poly-A); [3].
EX kidney (right and left),,,fetal; detectable; Northern blot; mRNA (poly-A); [1].
EX kidney (right and left),,,fetal; very high; Northern blot; mRNA (poly-A); [3].
EX liver,,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX liver,,,adult; low; Northern blot; RNA (undefined); [2].
EX liver,,,adult; medium; Northern blot; mRNA (poly-A); [3].
EX liver,,,adult; very low; Northern blot; RNA (undefined); [2].
EX liver,,,fetal; detectable; Northern blot; mRNA (poly-A); [1].
EX liver,,,fetal; very high; Northern blot; mRNA (poly-A); [3].
EX lung (right and left),,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX lung (right and left),,,adult; high; Northern blot; RNA (undefined); [2].
EX lung (right and left),,,adult; high; Northern blot; RNA (undefined); [2].
EX lung (right and left),,,adult; high; Northern blot; mRNA (poly-A); [3].
EX lung (right and left),,,fetal; detectable; Northern blot; mRNA (poly-A); [1].
EX lung (right and left),,,fetal; medium; Northern blot; mRNA (poly-A); [3].
EX muscles,,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX muscles,,,adult; medium; Northern blot; RNA (undefined); [2].
EX muscles,,,adult; medium; Northern blot; RNA (undefined); [2].
EX muscles,,,adult; medium; Northern blot; mRNA (poly-A); [3].
EX ovary (right and left),,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX ovary (right and left),,,adult; high; Northern blot; RNA (undefined); [2].
EX ovary (right and left),,,adult; high; Northern blot; RNA (undefined); [2].
EX ovary (right and left),,,adult; medium; Northern blot; mRNA (poly-A); [3].
EX ovary (right and left),,,adult; medium; RT-PCR; RNA (undefined); [2].
EX pancreas,,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX pancreas,,,adult; low; Northern blot; RNA (undefined); [2].
EX pancreas,,,adult; low; Northern blot; RNA (undefined); [2].
EX pancreas,,,adult; medium; Northern blot; mRNA (poly-A); [3].
EX placenta,,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX placenta,,,adult; very high; Northern blot; RNA (undefined); [2].
EX placenta,,,adult; very high; Northern blot; RNA (undefined); [2].
EX placenta,,,adult; very high; Northern blot; mRNA (poly-A); [3].
EX prostate gland,,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX prostate gland,,,adult; high; Northern blot; RNA (undefined); [2].
EX prostate gland,,,adult; high; Northern blot; RNA (undefined); [2].
EX prostate gland,,,adult; medium; Northern blot; mRNA (poly-A); [3].
EX prostate gland,,,adult; very low; RT-PCR; RNA (undefined); [2].
EX small intestine,,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX small intestine,,,adult; medium; Northern blot; RNA (undefined); [2].
EX small intestine,,,adult; medium; Northern blot; RNA (undefined); [2].
EX small intestine,,,adult; medium; Northern blot; mRNA (poly-A); [3].
EX small intestine,,,adult; very low; RT-PCR; RNA (undefined); [2].
EX spleen,,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX spleen,,,adult; medium; Northern blot; mRNA (poly-A); [3].
EX spleen,,,adult; very high; Northern blot; RNA (undefined); [2].
EX spleen,,,adult; very high; Northern blot; RNA (undefined); [2].
EX spleen,,,adult; very low; RT-PCR; RNA (undefined); [2].
EX testis (right and left),,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX testis (right and left),,,adult; high; Northern blot; RNA (undefined); [2].
EX testis (right and left),,,adult; high; Northern blot; RNA (undefined); [2].
EX testis (right and left),,,adult; very high; Northern blot; mRNA (poly-A); [3].
EX testis (right and left),,,adult; very high; RT-PCR; RNA (undefined); [2].
EX thymus,,,adult; detectable; Northern blot; mRNA (poly-A); [1].
EX thymus,,,adult; low; Northern blot; mRNA (poly-A); [3].
EX thymus,,,adult; medium; Northern blot; RNA (undefined); [2].
EX thymus,,,adult; medium; Northern blot; RNA (undefined); [2].
EX thymus,,,adult; very low; RT-PCR; RNA (undefined); [2].
XX
FF binds to DNA R01946 cooperatively with MafK [2];
XX
IN T09069 ATF-1-isoform1; human, Homo sapiens.
IN T00167 ATF-2-isoform1; human, Homo sapiens.
IN T18798 ATFa-isoform3; human, Homo sapiens.
IN T04798 Bach1t; human, Homo sapiens.
IN T19051 c-MAF-isoform2; human, Homo sapiens.
IN T09550 CREBPA-Alpha; human, Homo sapiens.
IN T18883 CREM-Ia; human, Homo sapiens.
IN T09646 MafB; human, Homo sapiens.
IN T09572 MafG; human, Homo sapiens.
IN T09555 MafK; human, Homo sapiens.
XX
MX M00495 V$BACH1_01.
MX M07374 V$BACH1_Q3.
MX M07296 V$MAF_Q4.
MX M00983 V$MAF_Q6_01.
XX
BS R01946.
XX
DR TRANSPATH: MO000028601.
DR EMBL: AB002803;
DR EMBL: AF026199;
DR UniProtKB: O14867;
XX
RN [1]; RE0016912.
RX PUBMED: 9479503.
RA Ohira M., Seki N., Nagase T., Ishikawa K., Nomura N., Ohara O.
RT Characterization of a human homolog (BACH1) of the mouse Bach1 gene encoding a BTB-basic leucine zipper transcription factor and its mapping to chromosome 21q22.1
RL Genomics 47:300-306 (1998).
RN [2]; RE0016918.
RX PUBMED: 11069897.
RA Kanezaki R., Toki T., Yokoyama M., Yomogida K., Sugiyama K., Yamamoto M., Igarashi K., Ito E.
RT Transcription factor BACH1 is recruited to the nucleus by its novel alternative spliced isoform
RL J. Biol. Chem. 276:7278-7284 (2001).
RN [3]; RE0016919.
RX PUBMED: 9544839.
RA Blouin J. L., Duriaux Sail G., Guipponi M., Rossier C., Pappasavas M. P., Antonarakis S. E.
RT Isolation of the human BACH1 transcription regulator gene, which maps to chromosome 21q22.1
RL Hum. Genet. 102:282-288 (1998).
RN [4]; RE0048287.
RX PUBMED: 12805554.
RA Newman J. R., Keating A. E.
RT Comprehensive identification of human bZIP interactions with coiled-coil arrays.
RL Science 300:2097-2101 (2003).
XX
//