AC T09069
XX
ID T09069
XX
DT 14.06.2006 (created); kau.
CO Copyright (C), QIAGEN.
XX
FA ATF-1-isoform1
XX
SY activating transcription factor 1; ATF1; EWS-ATF1; FUS/ATF-1; TREB-36; TREB36.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G005792 ATF1; HGNC: ATF1.
XX
CL C0008; bZIP.
XX
SZ 271 AA; 29.2 kDa (cDNA) (calc.).
XX
SQ MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILAR
SQ RPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQL
SQ ASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQ
SQ IRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKC
SQ LENRVAVLENQNKTLIEELKTLKDLYSNKSV
XX
SC Swiss-Prot#P18846
XX
FT 31 90 
PS50953; KID.
FT 43 83 
PF02173; pKID domain.
FT 102 180 
glutamine-rich region (15/79) [10].
FT 211 268 
SM00338; brlzneu.
FT 211 270 
PF00170; bZIP transcription factor.
FT 213 264 
PS50217; BZIP.
XX
IN T04791 Bach1; human, Homo sapiens.
IN T08887 brca1-isoform1; human, Homo sapiens.
IN T15204 brca1; Mammalia.
IN T08562 CREB1; human, Homo sapiens.
IN T18883 CREM-Ia; human, Homo sapiens.
IN T18884 CREM-Ib; human, Homo sapiens.
IN T09588 E4BP4; human, Homo sapiens.
IN T18885 ICER-xbb1; human, Homo sapiens.
XX
MX M07034 V$ATF1_Q3.
MX M00691 V$ATF1_Q6.
MX M01861 V$ATF1_Q6_01.
MX M00981 V$CREBATF_Q6.
MX M00801 V$CREB_Q3.
XX
BS R60518.
BS R25046.
BS R00780.
XX
DR TRANSPATH: MO000082924.
DR EMBL: X55544;
DR UniProtKB: P18846;
XX
RN [1]; RE0000062.
RX PUBMED: 3416354.
RA Horikoshi M., Hai T., Lin Y.-S., Green M. R., Roeder R. G.
RT Transcription factor ATF interacts with the TATA factor to facilitate establishment of a preinitiation complex
RL Cell 54:1033-1042 (1988).
RN [2]; RE0000186.
RX PUBMED: 2142019.
RA Liu F., Green M. R. R.
RT A specific member of the ATF transcription factor family can mediate transcription activation by the adenovirus E1a protein
RL Cell 61:1217-1224 (1990).
RN [3]; RE0000666.
RX PUBMED: 2516827.
RA Hai T., Liu F., Coukos W. J., Green M. R.
RT Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers
RL Genes Dev. 3:2083-2090 (1989).
RN [4]; RE0001106.
RX PUBMED: 1655749.
RA Rehfuss R. P., Walton K. M., Loriaux M. M., Goodman R. H.
RT The cAMP-regulated enhancer-binding protein ATF-1 activates transcription in response to cAMP-dependent protein kinase A
RL J. Biol. Chem. 266:18431-18434 (1991).
RN [5]; RE0001663.
RX PUBMED: 1831536.
RA Jones C., Lee K. A. W.
RT E1A-mediated activation of the adenovirus E4 promoter can occur independently of the cellular transcription factor E4F
RL Mol. Cell. Biol. 11:4297-4305 (1991).
RN [6]; RE0002228.
RX PUBMED: 8332500.
RA Lemaigre F. P., Ace C. I., Green M. R.
RT The cAMP response element binding protein, CREB, is a potent inhibitor of diverse transcriptional activators
RL Nucleic Acids Res. 21:2907-2911 (1993).
RN [7]; RE0002270.
RX PUBMED: 2835770.
RA Lin Y.-S., Green M. R.
RT Interaction of a common cellular transcription factor, ATF, with regulatory elements in both E1a- and cyclic AMP-inducible promoters
RL Proc. Natl. Acad. Sci. USA 85:3396-3400 (1988).
RN [8]; RE0002647.
RX PUBMED: 1646483.
RA Sheng M., Thompson M. A., Greenberg M. E.
RT CREB: A Ca2+-regulated transcription factor phosphorylated by calmodulin-dependent kinases
RL Science 252:1427-1430 (1991).
RN [9]; RE0003152.
RX PUBMED: 2960975.
RA Lee K.A.W., Hai T.-Y., Raman L.S., Thimmappaya B., Hurst H.C., Jones N.C., Green M.R.
RT A cellular protein, activating transcription factor, activates transcription of multiple E1A-inducible adenovirus early promotors
RL Proc. Natl. Acad. Sci. USA 84:8355-8359 (1987).
RN [10]; RE0003157.
RX PUBMED: 2196176.
RA Yoshimura T., Fujisawa J.-I., Yoshida M.
RT Multiple cDNA clones encoding nuclear proteins that bind to the tax-dependent enhancer of HTLV-1: all contain a leucine zipper structure and basic amino acid domain
RL EMBO J. 9:2537-2542 (1990).
RN [11]; RE0004643.
RX PUBMED: 8355695.
RA Kerppola T. K., Curran T.
RT Selective DNA bending by a variety of bZIP proteins
RL Mol. Cell. Biol. 13:5479-5489 (1993).
RN [12]; RE0004872.
RX PUBMED: 7630732.
RA Kim J., Struhl K.
RT Determinants of half-site spacing preferences that distinguish AP-1 and ATF/CREB bZIP domains
RL Nucleic Acids Res. 23:2531-2537 (1995).
RN [13]; RE0005255.
RX PUBMED: 7637811.
RA Perini G., Wagner S., Green M. R.
RT Recognition of bZIP proteins by the human T-cell leukemia virus transactivator Tax
RL Nature 376:602-605 (1995).
RN [14]; RE0046520.
RX PUBMED: 10567391.
RA Kabe Y., Goto M., Shima D., Imai T., Wada T., Morohashi K., Shirakawa M., Hirose S., Handa H.
RT The role of human MBF1 as a transcriptional coactivator
RL J. Biol. Chem. 274:34196-202 (1999).
RN [15]; RE0047872.
RX PUBMED: 9685505.
RA Yamaguchi Y., Wada T., Suzuki F., Takagi T., Hasegawa J., Handa H.
RT Casein kinase II interacts with the bZIP domains of several transcription factors.
RL Nucleic Acids Res. 26:3854-3861 (1998).
RN [16]; RE0048287.
RX PUBMED: 12805554.
RA Newman J. R., Keating A. E.
RT Comprehensive identification of human bZIP interactions with coiled-coil arrays.
RL Science 300:2097-2101 (2003).
RN [17]; RE0050340.
RX PUBMED: 10945975.
RA Houvras Y., Benezra M., Zhang H., Manfredi J. J., Weber B. L., Licht J. D.
RT BRCA1 physically and functionally interacts with ATF1.
RL J. Biol. Chem. 275:36230-36237 (2000).
XX
//