AC T08887
XX
ID T08887
XX
DT 04.05.2006 (created); jag.
DT 04.06.2014 (updated); yre.
CO Copyright (C), QIAGEN.
XX
FA brca1-isoform1
XX
SY BRC1; breast cancer type 1 susceptibility protein.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G002124 BRCA1; HGNC: BRCA1.
XX
CL C0049; RING.
XX
SZ 1863 AA; 207.7 kDa (cDNA) (calc.).
XX
SQ MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
SQ CPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKD
SQ EVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYI
SQ ELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQ
SQ PSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVE
SQ KAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPC
SQ SENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVD
SQ EYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTEN
SQ LIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTE
SQ QNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNI
SQ HNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPV
SQ RHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKE
SQ FVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQ
SQ ESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHS
SQ RETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVT
SQ FECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRG
SQ NETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIP
SQ STVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKL
SQ NAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSS
SQ HASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQ
SQ GYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENL
SQ LSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGS
SQ SKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSE
SQ DCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALE
SQ DLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSK
SQ CPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEG
SQ TPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTT
SQ DTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLI
SQ TEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDV
SQ VNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTL
SQ GTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPH
SQ SHY
XX
SC translated from EMBL #U14680
XX
FT 24 64 
zinc finger (C3HC4 type) [35].
FT 24 64 
PF00097; Zinc finger, C3HC4 type (RING finger).
FT 24 64 
SM00184; ring_2.
FT 24 65 
PS50089; ZF_RING_2.
FT 65 1821 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 224 500 
BRCT domain 1 (interaction with p53) [36].
FT 341 748 
ZBRK1 interaction domain [35].
FT 1293 1558 
second transactivation domain [38].
FT 1560 1863 
transactivation domain in the C-terminus [38].
FT 1642 1723 
PF00533; BRCA1 C Terminus (BRCT) domain.
FT 1642 1736 PS50172; BRCT.
FT 1644 1726 SM00292; BRCT_7.
FT 1756 1842 PF00533; BRCA1 C Terminus (BRCT) domain.
FT 1756 1855 PS50172; BRCT.
FT 1758 1845 SM00292; BRCT_7.
FT 1760 1863 BRCT domain 2 (interaction with p53, CBP-2) [37].
XX
IN T09069 ATF-1-isoform1; human, Homo sapiens.
IN T09252 Bach1; human, Homo sapiens.
IN T15118 CBP; Mammalia.
IN T34272 EED; human, Homo sapiens.
IN T00261 ER-alpha; human, Homo sapiens.
IN T09637 ER-alpha; Mammalia.
IN T16154 EZH2; mouse, Mus musculus.
IN T04106 HDAC1; human, Homo sapiens.
IN T25625 hdac2; human, Homo sapiens.
IN T23091 p300; Mammalia.
IN T00671 p53; human, Homo sapiens.
IN T25008 pRb; Mammalia.
IN T09538 Smad3; Mammalia.
IN T01492 STAT1alpha; human, Homo sapiens.
XX
DR TRANSPATH: MO000080982.
DR EMBL: U14680;
DR UniProtKB: P38398;
XX
RN [1]; RE0017512.
RX PUBMED: 10792030.
RA Ouchi T., Lee S. W., Ouchi M., Aaronson S. A., Horvath C. M.
RT Collaboration of signal transducer and activator of transcription 1 (STAT1) and BRCA1 in differential regulation of IFN-gamma target genes.
RL Proc. Natl. Acad. Sci. USA 97:5208-5213 (2000).
RN [2]; RE0021190.
RX PUBMED: 11114888.
RA Tibbetts R. S., Cortez D, Brumbaugh K. M., Scully R., Livingston D., Elledge S. J., Abraham, R. T.
RT Functional interactions between BRCA1 and the checkpoint kinase ATR during genotoxic stress
RL Genes Dev. 14:2989-3002 (2000).
RN [3]; RE0027548.
RX PUBMED: 10608806.
RA Kim S. T., Lim D. S., Canman C. E., Kastan M. B.
RT Substrate specificities and identification of putative substrates of ATM kinase family members.
RL J. Biol. Chem. 274:37538-43 (1999).
RN [4]; RE0027653.
RX PUBMED: 10783165.
RA Wang Y., Cortez D., Yazdi P., Neff N., Elledge S. J., Qin J.
RT BASC, a super complex of BRCA1-associated proteins involved in the recognition and repair of aberrant DNA structures.
RL Genes Dev. 14:927-39 (2000).
RN [5]; RE0030307.
RX PUBMED: 12773400.
RA Foray N., Marot D., Gabriel A., Randrianarison V., Carr A. M., Perricaudet M., Ashworth A., Jeggo P.
RT A subset of ATM- and ATR-dependent phosphorylation events requires the BRCA1 protein.
RL EMBO J. 22:2860-71 (2003).
RN [6]; RE0031752.
RX PUBMED: 15205325.
RA Gilmore P. M., McCabe N., Quinn J. E., Kennedy R. D., Gorski J. J., Andrews H. N., McWilliams S., Carty M., Mullan P. B., Duprex W. P., Liu E. T., Johnston P. G., Harkin D. P.
RT BRCA1 interacts with and is required for paclitaxel-induced activation of mitogen-activated protein kinase kinase kinase 3.
RL Cancer Res. 64:4148-54 (2004).
RN [7]; RE0041933.
RX PUBMED: 11163768.
RA Gao B., Shen X., Kunos G., Meng Q., Goldberg I. D., Rosen E. M., Fan S.
RT Constitutive activation of JAK-STAT3 signaling by BRCA1 in human prostate cancer cells
RL FEBS Lett. 488:179-184 (2001).
RN [8]; RE0048028.
RX PUBMED: 14550570.
RA Yan J., Zhu J., Zhong H., Lu Q., Huang C., Ye Q.
RT BRCA1 interacts with FHL2 and enhances FHL2 transactivation function.
RL FEBS Lett. 553:183-189 (2003).
RN [9]; RE0048205.
RX PUBMED: 10220405.
RA Yarden R. I., Brody L. C.
RT BRCA1 interacts with components of the histone deacetylase complex.
RL Proc. Natl. Acad. Sci. USA 96:4983-4988 (1999).
RN [10]; RE0049971.
RX PUBMED: 10655477.
RA Pao G. M., Janknecht R., Ruffner H., Hunter T., Verma I. M.
RT CBP/p300 interact with and function as transcriptional coactivators of BRCA1.
RL Proc. Natl. Acad. Sci. USA 97:1020-1025 (2000).
RN [11]; RE0050302.
RX PUBMED: 15159397.
RA Fabbro M., Savage K., Hobson K., Deans A. J., Powell S. N., McArthur G. A., Khanna K. K.
RT BRCA1-BARD1 complexes are required for p53Ser-15 phosphorylation and a G1/S arrest following ionizing radiation-induced DNA damage.
RL J. Biol. Chem. 279:31251-31258 (2004).
RN [12]; RE0050327.
RX PUBMED: 16818604.
RA Yu X., Fu S., Lai M., Baer R., Chen J.
RT BRCA1 ubiquitinates its phosphorylation-dependent binding partner CtIP.
RL Genes Dev. 20:1721-1726 (2006).
RN [13]; RE0050340.
RX PUBMED: 10945975.
RA Houvras Y., Benezra M., Zhang H., Manfredi J. J., Weber B. L., Licht J. D.
RT BRCA1 physically and functionally interacts with ATF1.
RL J. Biol. Chem. 275:36230-36237 (2000).
RN [14]; RE0050357.
RX PUBMED: 17603999.
RA Hsu L. C.
RT Identification and functional characterization of a PP1-binding site in BRCA1.
RL Biochem. Biophys. Res. Commun. 360:507-512 (2007).
RN [15]; RE0050417.
RX PUBMED: 16326698.
RA Moreau K., Dizin E., Ray H., Luquain C., Lefai E., Foufelle F., Billaud M., Lenoir G. M., Venezia N. D.
RT BRCA1 affects lipid synthesis through its interaction with acetyl-CoA carboxylase.
RL J. Biol. Chem. 281:3172-3181 (2006).
RN [16]; RE0050437.
RX PUBMED: 16782705.
RA Dizin E., Gressier C., Magnard C., Ray H., Decimo D., Ohlmann T., Dalla Venezia N.
RT BRCA1 interacts with poly(A)-binding protein: implication of BRCA1 in translation regulation.
RL J. Biol. Chem. 281:24236-24246 (2006).
RN [17]; RE0050527.
RX PUBMED: 17616665.
RA Venere M., Snyder A., Zgheib O., Halazonetis T. D.
RT Phosphorylation of ATR-interacting protein on Ser239 mediates an interaction with breast-ovarian cancer susceptibility 1 and checkpoint function.
RL Cancer Res. 67:6100-6105 (2007).
RN [18]; RE0050559.
RX PUBMED: 16322207.
RA Martin S. A., Ouchi T.
RT BRCA1 phosphorylation regulates caspase-3 activation in UV-induced apoptosis.
RL Cancer Res. 65:10657-10662 (2005).
RN [19]; RE0050576.
RX PUBMED: 11278964.
RA Gatei M., Zhou B. B., Hobson K., Scott S., Young D., Khanna K. K.
RT Ataxia telangiectasia mutated (ATM) kinase and ATM and Rad3 related kinase mediate phosphorylation of Brca1 at distinct and overlapping sites. In vivo assessment using phospho-specific antibodies.
RL J. Biol. Chem. 276:17276-17280 (2001).
RN [20]; RE0050627.
RX PUBMED: 16698035.
RA Ray H., Moreau K., Dizin E., Callebaut I., Venezia N. D.
RT ACCA phosphopeptide recognition by the BRCT repeats of BRCA1.
RL J. Mol. Biol. 359:973-982 (2006).
RN [21]; RE0050647.
RX PUBMED: 16391231.
RA Greenberg R. A., Sobhian B., Pathania S., Cantor S. B., Nakatani Y., Livingston D. M.
RT Multifactorial contributions to an acute DNA damage response by BRCA1/BARD1-containing complexes.
RL Genes Dev. 20:34-46 (2006).
RN [22]; RE0050665.
RX PUBMED: 17621610.
RA Yan J., Kim Y. S., Yang X. P., Li L. P., Liao G., Xia F., Jetten A. M.
RT The ubiquitin-interacting motif containing protein RAP80 interacts with BRCA1 and functions in DNA damage repair response.
RL Cancer Res. 67:6647-6656 (2007).
RN [23]; RE0050820.
RX PUBMED: 12400015.
RA Kawai H., Li H., Chun P., Avraham S., Avraham H. K.
RT Direct interaction between BRCA1 and the estrogen receptor regulates vascular endothelial growth factor (VEGF) transcription and secretion in breast cancer cells.
RL Oncogene 21:7730-7739 (2002).
RN [24]; RE0050835.
RX PUBMED: 12438214.
RA Liu Y., Virshup D. M., White R. L., Hsu L. C.
RT Regulation of BRCA1 phosphorylation by interaction with protein phosphatase 1alpha.
RL Cancer Res. 62:6357-6361 (2002).
RN [25]; RE0050845.
RX PUBMED: 16969499.
RA Quaresima B., Faniello M. C., Baudi F., Crugliano T., Di Sanzo M., Cuda G., Costanzo F., Venuta S.
RT Missense mutations of BRCA1 gene affect the binding with p53 both in vitro and in vivo.
RL Oncol. Rep. 16:811-815 (2006).
RN [26]; RE0050989.
RX PUBMED: 16403807.
RA Morris J. R., Pangon L., Boutell C., Katagiri T., Keep N. H., Solomon E.
RT Genetic analysis of BRCA1 ubiquitin ligase activity and its relationship to breast cancer susceptibility.
RL Hum. Mol. Genet. 15:599-606 (2006).
RN [27]; RE0051005.
RX PUBMED: 16109739.
RA Ma Y., Katiyar P., Jones L. P., Fan S., Zhang Y., Furth P. A., Rosen E. M.
RT The breast cancer susceptibility gene BRCA1 regulates progesterone receptor signaling in mammary epithelial cells.
RL Mol. Endocrinol. 20:14-34 (2006).
RN [28]; RE0051040.
RX PUBMED: 16101277.
RA Varma A. K., Brown R. S., Birrane G., Ladias J. A.
RT Structural basis for cell cycle checkpoint control by the BRCA1-CtIP complex.
RL Biochemistry 44:10941-10946 (2005).
RN [29]; RE0051123.
RX PUBMED: 15735739.
RA Dubrovska A., Kanamoto T., Lomnytska M., Heldin C. H., Volodko N., Souchelnytskyi S.
RT TGFbeta1/Smad3 counteracts BRCA1-dependent repair of DNA damage.
RL Oncogene 24:2289-2297 (2005).
RN [30]; RE0051332.
RX PUBMED: 10542266.
RA Altiok S., Batt D., Altiok N., Papautsky A., Downward J., Roberts T. M., Avraham H.
RT Heregulin induces phosphorylation of BRCA1 through phosphatidylinositol 3-Kinase/AKT in breast cancer cells.
RL J. Biol. Chem. 274:32274-32278 (1999).
RN [31]; RE0051339.
RX PUBMED: 11016625.
RA Chen J.
RT Ataxia telangiectasia-related protein is involved in the phosphorylation of BRCA1 following deoxyribonucleic acid damage.
RL Cancer Res. 60:5037-5039 (2000).
RN [32]; RE0051647.
RX PUBMED: 15166217.
RA Choudhury A. D., Xu H., Baer R.
RT Ubiquitination and proteasomal degradation of the BRCA1 tumor suppressor is regulated during cell cycle progression.
RL J. Biol. Chem. 279:33909-33918 (2004).
RN [33]; RE0063959.
RX PUBMED: 18452305.
RA Shen Y., Tong L.
RT Structural evidence for direct interactions between the BRCT domains of human BRCA1 and a phospho-peptide from human ACC1.
RL Biochemistry 47:5767-5773 (2008).
RN [34]; RE0064049.
RX PUBMED: 12360400.
RA Magnard C., Bachelier R., Vincent A., Jaquinod M., Kieffer S., Lenoir G. M., Venezia N. D.
RT BRCA1 interacts with acetyl-CoA carboxylase through its tandem of BRCT domains.
RL Oncogene 21:6729-6739 (2002).
RN [35]; RE0035939.
RX PUBMED: 11090615.
RA Zheng L., Pan H., Li S., Flesken-Nikitin A., Chen P. L., Boyer T. G., Lee W. H.
RT Sequence-specific transcriptional corepressor function for BRCA1 through a novel zinc finger protein, ZBRK1.
RL Mol. Cell 6:757-768 (2000).
RN [36]; RE0017598.
RX PUBMED: 9582019.
RA Zhang H., Somasundaram K., Peng Y., Tian H., Zhang H., Bi D., Weber B. L., El-Deiry W. S.
RT BRCA1 physically associates with p53 and stimulates its transcriptional activity.
RL Oncogene 16:1713-1721 (1998).
RN [37]; RE0017774.
RX PUBMED: 9926942.
RA Chai Y. L., Cui J., Shao N., Shyam E., Reddy P., Rao V. N.
RT The second BRCT domain of BRCA1 proteins interacts with p53 and stimulates transcription from the p21WAF1/CIP1 promoter.
RL Oncogene 18:263-268 (1999).
RN [38]; RE0017377.
RX PUBMED: 10448078.
RA Law D. J., Du M., Law G. L., Merchant J. L.
RT ZBP-99 defines a conserved family of transcription factors and regulates ornithine decarboxylase gene expression
RL Biochem. Biophys. Res. Commun. 262:113-120 (1999).
XX
//