TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04996 XX ID T04996 XX DT 03.12.2001 (created); mas. DT 01.12.2011 (updated); hna. CO Copyright (C), QIAGEN. XX FA ZBP89 XX SY transcription factor ZBP-89; zinc finger DNA-binding protein 89; zinc finger protein 148; ZNF148. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002930 ZNF148; HGNC: ZNF148. XX CL C0001; CH. XX SZ 794 AA; 89.0 kDa (calc.). XX SQ MNIDDKLEGLFLKCGGIDEMQSSRTMVVMGGVSGQSTVSGELQDSVLQDRSMPHQEILAA SQ DEVLQESEMRQQDMISHDELMVHEETVKNDEEQMETHERLPQGLQYALNVPISVKQEITF SQ TDVSEQLMRDKKQIREPVDLQKKKKRKQRSPAKILTINEDGSLGLKTPKSHVCEHCNAAF SQ RTNYHLQRHVFIHTGEKPFQCSQCDMRFIQKYLLQRHEKIHTGEKPFRCDECGMRFIQKY SQ HMERHKRTHSGEKPYQCEYCLQYFSRTDRVLKHKRMCHENHDKKLNRCAIKGGLLTSEED SQ SGFSTSPKDNSLPKKKRQKTEKKSSGMDKESALDKSDLKKDKNDYLPLYSSSTKVKDEYM SQ VAEYAVEMPHSSVGGSHLEDASGEIHPPKLVLKKINSKRSLKQPLEQNQTISPLSTYEES SQ KVSKYAFELVDKQALLDSEGNADIDQVDNLQEGPSKPVHSSTNYDDAMQFLKKKRYLQAA SQ SNNSREYALNVGTIASQPSVTQAAVASVIDESTTASILESQALNVEIKSNHDKNVIPDEV SQ LQTLLDHYSHKANGQHEISFSVADTEVTSSISINSSEVPEVTPSENVGSSSQASSSDKAN SQ MLQEYSKFLQQALDRTSQNDAYLNSPSLNFVTDNQTLPNQPAFSSIDKQVYATMPINSFR SQ SGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPV SQ HQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAG SQ MTSSPDATTGQTFG XX SC translated from EMBL #AF039019 XX FT 56 97 acidic region [2]. FT 73 656 PF00478; IMP dehydrogenase / GMP reductase domain. FT 131 149 basic region [2]. FT 171 193 PF00096; zf-C2H2. FT 171 193 SM00355; c2h2final6. FT 171 198 PS50157; ZINC_FINGER_C2H2_2. FT 173 193 zinc finger [2]. FT 199 221 PF00096; zf-C2H2. FT 199 221 SM00355; c2h2final6. FT 199 226 PS50157; ZINC_FINGER_C2H2_2. FT 201 214 zinc finger [2]. FT 227 249 PF00096; zf-C2H2. FT 227 249 SM00355; c2h2final6. FT 227 254 PS50157; ZINC_FINGER_C2H2_2. FT 229 249 zinc finger [2]. FT 255 278 PF00096; zf-C2H2. FT 255 278 SM00355; c2h2final6. FT 255 283 PS50157; ZINC_FINGER_C2H2_2. FT 257 278 zinc finger [2]. FT 313 323 basic region [2]. FT 472 475 basic region [2]. XX SF high sequence similarity to T04995 [2]; SF cDNA sequence almost identical to that of human ht-beta gene except for a single-nucleotide deletion in ht-beta which leads to a premature stop codon and a truncated protein with a length of 494 amino acids: the deletion in ht-beta is maybe due to somatic mutation [3]; SF interestingly ht-beta acts as transcriptional activator (on T-cell receptor gene, EGF-induced) [1]; SF while ht-beta acts as transcriptional repressor in many contexts [1] [4] [5] [6] [7] [8]; XX FF binds to G/C-rich elements and mediates p53-independent apoptosis [9]; FF binds GC-rich region of promoters [4]; FF controls expression of the gene for rat gastrin, mouse BFCOL1 type 1collagen, human beta-enolase, and human ornithine decarboxylase (ODC) [3] [6] [7] [8]; FF enhances human stromelysin promoter activity [4]; XX MX M00721 V$CACCCBINDINGFACTOR_Q6. MX M01816 V$ZBP89_Q4. MX M07397 V$ZBP89_Q4_01. XX BS R19122. BS R19124. BS R19125. BS R11771. BS R37333. BS R37335. BS R19135. BS R20713. BS R31980. BS R19120. XX DR TRANSPATH: MO000028759. DR EMBL: AF039019; DR EMBL: AJ236885; DR EMBL: U96633; DR UniProtKB: Q9UQR1; XX RN [1]; RE0002925. RX PUBMED: 8355710. RA Wang Y., Kobori J. K., Hood L. RT The ht beta gene encodes a novel CACCC box-binding protein that regulates T-cell receptor gene expression RL Mol. Cell. Biol. 13:5691-5701 (1993). RN [2]; RE0017378. RX PUBMED: 10405178. RA Lisowsky T., Polosa P. L., Sagliano A., Roberti M., Gadaleta M. N., Cantatore P. RT Identification of human GC-box-binding zinc finger protein, a new Kruppel-like zinc finger protein, by the yeast one-hybrid screening with a GC-rich target sequence RL FEBS Lett. 453:369-374 (1999). RN [3]; RE0017379. RX PUBMED: 9457682. RA Law D. J., Tarle S. A., Merchant J. L. RT The human ZBP-89 homolog, located at chromosome 3q21, represses gastrin gene expression RL Mamm. Genome 9:165-167 (1998). RN [4]; RE0017380. RX PUBMED: 10359087. RA Ye S., Whatling C., Watkins H., Henney A. RT Human stromelysin gene promoter activity is modulated by transcription factor ZBP-89. RL FEBS Lett. 450:268-272 (1999). RN [5]; RE0017385. RX PUBMED: 8943318. RA Merchant J. L., Iyer G. R., Taylor B. R., Kitchen J. R., Mortensen E. R., Wang Z., Flintoft R. J., Michel J. B., Bassel-Duby R. RT ZBP-89, a Kruppel-like zinc finger protein, inhibits epidermal growth factor induction of the gastrin promoter RL Mol. Biol. Cell 16:6644-6653 (1996). RN [6]; RE0017387. RX PUBMED: 9030551. RA Hasegawa T., Takeuchi A., Miyaishi O., Isobe K. i., de Crombrugghe B. RT Cloning and characterization of a transcription factor that binds to the proximal promoters of the two mouse type I collagen genes RL J. Biol. Chem. 272:4915-4923 (1997). RN [7]; RE0017388. RX PUBMED: 9417107. RA Passantino R., Antona V., Barbieri G., Rubino P., Melchionna R., Cossu G., Feo S., Giallongo A. RT Negative regulation of beta enolase gene transcription in embryonic muscle is dependent upon a zinc finger factor that binds to the G-rich box within the muscle-specific enhancer. RL J. Biol. Chem. 273:484-494 (1998). RN [8]; RE0017389. RX PUBMED: 9685330. RA Law G. L., Itoh H., Law D. J., Mize G. J., Merchant J. L., Morris D. R. RT Transcription factor ZBP-89 regulates the activity of the ornithine decarboxylase promoter RL J. Biol. Chem. 273:19955-19964 (1998). RN [9]; RE0030583. RX PUBMED: 14654702. RA Bai L., Merchant J. L. RT Transcription factor ZBP-89 is required for STAT1 constitutive expression. RL Nucleic Acids Res. 31:7264-70 (2003). XX //