TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T05132 XX ID T05132 XX DT 27.05.2002 (created); mas. DT 03.12.2010 (updated); mkl. CO Copyright (C), QIAGEN. XX FA GLIS2 XX SY GLI-Kruppel family member GLI5; Gli5; Glis 2; Glis-2; Glis2; Klf16; Krueppel-like Zinc Finger Protein Glis2; MGC36775; Nkl. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004146 Glis2. XX CL C0001; CH. XX SZ 521 AA; 55.9 kDa (calc.). XX SQ MHSLDEPLDLKLSITKLRAAREKRERTLGVVRHHALHRELGLVDDSPAPGSPGSPPPGFL SQ LNPKFPEKVDGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPECQGNGDLPPLPTAVDFQPL SQ RYLDGVPSSFQFFLPLGSGGALHLPASSFLPPPKDKCLSPELPLAKQLVCRWAKCNQLFE SQ LLQDLVDHVNDHHVKPEQDARYCCHWEDCARHGRGFNARYKMLIHIRTHTNEKPHRCPTC SQ NKSFSRLENLKIHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGC SQ HKRYTDPSSLRKHIKAHGHFVSHEQQELLQLRPPPKPPLPTPDSGSYVSGAQIIIPNPAA SQ LFGGPSLPGLPLPLPPGPLDLSALACGNGGGGGGGIGPGLPGSVLPLNLAKNPLLPSPFG SQ AGGLGLPVVSLLGGSAGSKAEGEKGRGSVPARVLGLENHKTPLERTERSRSRPSPDGLPL SQ LPGTVLDLSTGNSAASSPEVLTPGWVVIPPGSVLLKPAVVN XX SC translated from EMBL #AF325913 XX FT 21 26 basic region (4/6) [2]. FT 30 148 contains activation domain, functional [2]. FT 148 171 contains repression domain, functional [2]. FT 168 193 SM00355; c2h2final6. FT 170 193 zinc finger1, C2H2-type (C-X2-4-C-X12-15-H-X3-4-H) [4]. FT 171 193 contains repression domain, functional [2]. FT 202 229 SM00355; c2h2final6. FT 204 229 zinc finger2, C2H2-type (C-X2-4-C-X12-15-H-X3-4-H) [4]. FT 207 234 PS50157; ZINC_FINGER_C2H2_2. FT 235 257 PF00096; zf-C2H2. FT 235 257 SM00355; c2h2final6. FT 235 262 PS50157; ZINC_FINGER_C2H2_2. FT 237 257 zinc finger3, C2H2-type (C-X2-4-C-X12-15-H-X3-4-H) [4]. FT 263 287 PF00096; zf-C2H2. FT 263 287 SM00355; c2h2final6. FT 263 292 PS50157; ZINC_FINGER_C2H2_2. FT 265 286 zinc finger4, C2H2-type (C-X2-4-C-X12-15-H-X3-4-H) [4]. FT 293 317 PF00096; zf-C2H2. FT 293 317 PS50157; ZINC_FINGER_C2H2_2. FT 293 317 SM00355; c2h2final6. FT 295 318 zinc finger5, C2H2-type (C-X2-4-C-X12-15-H-X3-4-H) [4]. XX SF contains 5 zinc finger domains [2]; SF closely related to GLI and ZIC subfamily of Krueppel-like zinc finger transcription factors [2]; SF high amino acid identity to GLI and ZIC family members in zinc finger domain (pos. 170-317) (49-57%) with highest identities in zinc finger 3 and 5 [2]; SF contains functional repression domain within zinc finger 1 [2]; SF 93% amino acid identity between human T05131 and mouse ortholog T05132 [1]; SF the zinc finger domains are highly homologous with chick NKL T06400 94% and frog NKL T06401 67% [3]; XX CP (adult): high levels in kidney and lower levels in heart, lung [2]; weak expression in prostate, colon, brain [2]; E9,5: cranial ganglia, dorsal root ganglia, neural tube, E10,5: broadly intermediate zone of the hindbrain, spinal cord, dorsal root ganglia, E12,5: ventricular zone [3] [2] [3]. EX brain,,,adult; low; Northern blot; total RNA; [2]. EX brain,,,adult; low; RT-PCR; RNA (undefined); [2]. EX colon,,,adult; low; Northern blot; total RNA; [2]. EX colon,,,adult; low; RT-PCR; RNA (undefined); [2]. EX heart,,,adult; low; Northern blot; total RNA; [2]. EX heart,,,adult; medium; RT-PCR; RNA (undefined); [2]. EX intestine,,,adult; detectable; RT-PCR; RNA (undefined); [2]. EX intestine,,,adult; low; Northern blot; total RNA; [2]. EX kidney (right and left),,,adult; high; RT-PCR; RNA (undefined); [2]. EX kidney (right and left),,,adult; very high; Northern blot; total RNA; [2]. EX liver,,,adult; detectable; RT-PCR; RNA (undefined); [2]. EX liver,,,adult; low; Northern blot; total RNA; [2]. EX lung,,,adult; medium; Northern blot; total RNA; [2]. EX lung,,,adult; medium; RT-PCR; RNA (undefined); [2]. EX mammary gland,,,adult; detectable; RT-PCR; RNA (undefined); [2]. EX mammary gland,,,adult; low; Northern blot; total RNA; [2]. EX muscles,,,adult; detectable; RT-PCR; RNA (undefined); [2]. EX muscles,,,adult; low; Northern blot; total RNA; [2]. EX oesophagus,,,adult; detectable; RT-PCR; RNA (undefined); [2]. EX oesophagus,,,adult; low; Northern blot; total RNA; [2]. EX pancreas,,,adult; low; Northern blot; total RNA; [2]. EX prostate gland,,,adult; low; Northern blot; total RNA; [2]. EX prostate gland,,,adult; low; RT-PCR; RNA (undefined); [2]. EX spleen,,,adult; detectable; RT-PCR; RNA (undefined); [2]. EX spleen,,,adult; low; Northern blot; total RNA; [2]. EX testis (right and left),,,adult; detectable; RT-PCR; RNA (undefined); [2]. EX testis (right and left),,,adult; low; Northern blot; total RNA; [2]. EX thymus,,,adult; detectable; RT-PCR; RNA (undefined); [2]. EX thymus,,,adult; low; Northern blot; total RNA; [2]. EX thyroid gland,,,adult; detectable; RT-PCR; RNA (undefined); [2]. EX thyroid gland,,,adult; low; Northern blot; total RNA; [2]. EX trachea,,,adult; detectable; RT-PCR; RNA (undefined); [2]. EX trachea,,,adult; low; Northern blot; total RNA; [2]. XX FF can function as repressor of basal transcription but contains both functional repression domains and functional autonomous transactivation domain [2]; FF transactivation and repressional activity cell-type dependent (e.g. activation domain increases transcriptional activity 200-fold in 293 cells but only 7-fold in MDCK cells) which may be due different expression levels of co-activators and co-repressors [2]; XX MX M02759 V$GLIS2_03. XX BS R16214. XX DR TRANSPATH: MO000032976. DR UniProtKB: Q8VDL9; XX RN [1]; RE0017825. RX PUBMED: 11738817. RA Zhang F., Jetten A. M. RT Genomic structure of the gene encoding the human GLI-related, Kruppel-like zinc finger protein GLIS2 RL Gene 280:49-57 (2001). RN [2]; RE0017826. RX PUBMED: 11741991. RA Zhang F., Nakanishi G., Kurebayashi S., Yoshino K., Perantoni A., Kim Y. S., Jetten A. M. RT Characterization of Glis2, a novel gene encoding a Gli-related, Kruppel-like transcription factor with transactivation and repressor functions. Roles in kidney development and neurogenesis RL J. Biol. Chem. 277:10139-10149 (2002). RN [3]; RE0025320. RX PUBMED: 11262234. RA Lamar E., Kintner C., Goulding M. RT Identification of NKL, a novel Gli-Kruppel zinc-finger protein that promotes neuronal differentiation. RL Development 128:1335-1346 (2001). RN [4]; RE0025419. RX PUBMED: 12042312. RA Kim Y. S., Lewandoski M., Perantoni A. O., Kurebayashi S., Nakanishi G., Jetten A. M. RT Identification of Glis1, a novel Gli-related, Kruppel-like zinc finger protein containing transactivation and repressor functions. RL J. Biol. Chem. 277:30901-30913 (2002). XX //