TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T05447 XX ID T05447 XX DT 22.02.2003 (created); oke. DT 02.09.2003 (updated); mkl. CO Copyright (C), QIAGEN. XX FA RFXAP XX SY regulatory factor X-associated protein. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G005120 Rfxap. XX SZ 231 AA; 24.8 kDa (calc.). XX SQ MEAQAVPEGSGPSTASPRTAPPVTVLVMRQDEAEADGALRPGLAGSEAAADAEDEAGDDD SQ ADLLDTSDPAGGGESAASPEELEDEDAEGGGAARRRGSKTCTYEGCRETTSQVAKQRKPW SQ MCKKHRNKMYKDKYKKKKSDQALGSGGPSAASTGNVKLEESTDNILSIVKQRTGSFGDRP SQ ARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQHFPGAPV XX SC translated from EMBL #AF335512 XX FT 47 91 acidic (aspartate-/glutamate-rich) region (19/45) [1]. FT 99 182 MCH class II isotype-specific function [1]. FT 115 139 basic (lysine-/arginine-rich) region (13/25) [1]. FT 205 225 glutamine-rich region (10/21) [1]. XX SF subunit of the RFX complex, for human complex see T05444, mouse RFXAP is functionally equivalent to human RFXAP [1]; SF C-terminal glutamine-rich region is essential for the RFX complex formation and for activation of all three MHC II isotypes [1]; SF isotype-specific region is required for expression of DQA and DPA, but not DRA [1]; XX FF important regulator of MHC class II gene expression; XX MX M00975 V$RFX_Q6. XX DR TRANSPATH: MO000034951. DR UniProtKB: Q8VCG9; XX RN [1]; RE0022533. RX PUBMED: 11486010. RA Peretti M., Villard J., Barras E., Zufferey M., Reith W. RT Expression of the three human major histocompatibility complex class II isotypes exhibits a differential dependence on the transcription factor RFXAP. RL Mol. Cell. Biol. 21:5699-5709 (2001). XX //