TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08732 XX ID T08732 XX DT 23.03.2006 (created); sri. DT 17.10.2014 (updated); msr. CO Copyright (C), QIAGEN. XX FA STAT5B XX SY mammary gland factor; MGF; signal transducer and activator of transcription 5 A; signal transducer and activator of transcription 5B; STAT5B; STF-IL-3. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G006768 Stat5b. XX CL C0039; STAT. XX SZ 786 AA; 89.9 kDa (cDNA) (calc.), 80 kDa (SDS) XX SQ MAMWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL SQ LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQSTYDRCPMELVRCIRHILYNEQRLV SQ REANNGSSPAGSLADAMSQKHLQINQTFEELRLITQDTENELKKLQQTQEYFIIQYQESL SQ RIQAQFAQLGQLNPQERMSRETALQQKQVSLETWLQREAQTLQQYRVELAEKHQKTLQLL SQ RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC SQ QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL SQ NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS SQ LKRIKRSDRRGAGSVTEEKFTILFDSQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA SQ TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNI SQ SSNHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK SQ QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL SQ GDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAADGYVKPQIKQVVPEFANASTDAGS SQ GATYMDQAPSPVVCPQAHYNMYPPNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQW SQ IPHAQS XX SC translated from EMBL:U21110 XX FT 2 126 PF02865; STAT protein, protein interaction domain. FT 138 330 PF01017; STAT protein, all-alpha domain. FT 332 583 PF02864; STAT protein, DNA binding domain. FT 336 654 PF00478; IMP dehydrogenase / GMP reductase domain. FT 587 676 SM00252; SH2_5. FT 589 670 PF00017; SH2 domain. FT 589 686 PS50001; SH2. XX FF Overexpression of constitutively active mutant STAT5ACA of this molecule leads to enhanced expression of IGF-I G014210 [2]; XX IN T29717 SIRT1; human, Homo sapiens. XX MX M00459 V$STAT5B_01. MX M00223 V$STAT_01. MX M00777 V$STAT_Q6. XX BS R17090. BS R14236. BS R19772. BS R19774. BS R11154. BS R36409. BS R36410. BS R41228. BS R60224. BS R04917. BS R36619. BS R34312. BS R36616. XX DR TRANSPATH: MO000079450. DR TRANSCOMPEL: C00607. DR TRANSCOMPEL: C00640. DR EMBL: U21110; DR EMBL: Z48539; DR UniProtKB: P42232; XX RN [1]; RE0030649. RX PUBMED: 10618497. RA Storz P., Doppler H., Pfizenmaier K., Muller G. RT Insulin selectively activates STAT5b, but not STAT5a, via a JAK2-independent signalling pathway in Kym-1 rhabdomyosarcoma cells. RL FEBS Lett. 464:159-63 (1999). RN [2]; RE0048761. RX PUBMED: 15677453. RA Wang Y., Jiang H. RT Identification of a distal STAT5-binding DNA region that may mediate growth hormone regulation of insulin-like growth factor-I gene expression. RL J. Biol. Chem. 280:10955-10963 (2005). RN [3]; RE0051941. RX PUBMED: 9544991. RA Berchtold S., Volarevic S., Moriggl R., Mercep M., Groner B. RT Dominant negative variants of the SHP-2 tyrosine phosphatase inhibit prolactin activation of Jak2 (janus kinase 2) and induction of Stat5 (signal transducer and activator of transcription 5)-dependent transcription. RL Mol. Endocrinol. 12:556-567 (1998). RN [4]; RE0054272. RX PUBMED: 11604235. RA Yamashita H., Nevalainen M. T., Xu J., LeBaron M. J., Wagner K. U., Erwin R. A., Harmon J. M., Hennighausen L., Kirken R. A., Rui H. RT Role of serine phosphorylation of Stat5a in prolactin-stimulated beta-casein gene expression. RL Mol. Cell. Endocrinol. 183:151-163 (2001). RN [5]; RE0054286. RX PUBMED: 11731617. RA Park S. H., Yamashita H., Rui H., Waxman D. J. RT Serine phosphorylation of GH-activated signal transducer and activator of transcription 5a (STAT5a) and STAT5b: impact on STAT5 transcriptional activity. RL Mol. Endocrinol. 15:2157-2171 (2001). RN [6]; RE0054298. RX PUBMED: 9804779. RA Yamashita H., Xu J., Erwin R. A., Farrar W. L., Kirken R. A., Rui H. RT Differential control of the phosphorylation state of proline-juxtaposed serine residues Ser725 of Stat5a and Ser730 of Stat5b in prolactin-sensitive cells. RL J. Biol. Chem. 273:30218-30224 (1998). RN [7]; RE0064920. RX PUBMED: 19109256. RA Chen J., Olsen J., Ford S., Mirza S., Walker A., Murphy J. M., Young I. G. RT A new isoform of interleukin-3 receptor {alpha} with novel differentiation activity and high affinity binding mode. RL J. Biol. Chem. 284:5763-5773 (2009). XX //