TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08967 XX ID T08967 XX DT 30.05.2006 (created); rad. DT 03.12.2009 (updated); din. CO Copyright (C), QIAGEN. XX FA NF-YB XX SY CBF-A; CP1-A; NF-YB; NFYB; nuclear transcription factor-Y beta. XX OS rat, Rattus norvegicus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004111 Nfyb. XX CL C0030; histone fold. XX SZ 207 AA; 22.8 kDa (cDNA) (calc.), 32 kDa (SDS) XX SQ MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLP SQ IANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF SQ AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVSATDGLSEELTEEAFTNQLPAGLIT SQ ADGQQQNVMVYTTSYQQISGVQQIQFS XX SC translated from EMBL:M55045 XX FT 57 87 DNA-binding domain (DBD) within A/B/C heterotrimer [3]. FT 57 122 PF00808; Histone-like transcription factor (CBF/. FT 61 125 predicted histone fold triple helix [4]. FT 61 125 PS50028; HIST_TAF. FT 63 102 CBF-C interaction domain 1 [3]. FT 64 125 histone-fold motif [3]. FT 92 99 CBF-B interaction domain in A/C-heterodimer [3]. FT 109 142 CBF-C interaction domain 2 [3]. XX IN T08519 C2TA-isoform1; human, Homo sapiens. XX MX M00209 V$NFY_C. MX M07302 V$NFY_Q3. MX M00185 V$NFY_Q6. MX M00775 V$NFY_Q6_01. XX BS R00232. XX DR TRANSPATH: MO000082113. DR EMBL: M55045; DR UniProtKB: P63140; XX RN [1]; RE0000944. RX PUBMED: 2266139. RA Vuorio T., Maity S. N., de Crombrugghe B. RT Purification and molecular cloning of the A chain of a rat heteromeric CCAAT-binding protein. Sequence identity with the yeast HAP3 transcription factor RL J. Biol. Chem. 265:22480-22486 (1990). RN [2]; RE0002858. RX PUBMED: 1644837. RA Maity S. N., Sinha S., Ruteshouser E. C., de Crombrugghe B. RT Three different polypeptides are necessary for DNA binding of the mammalian heteromeric CCAAT binding factor RL J. Biol. Chem. 267:16574-16580 (1992). RN [3]; RE0003817. RX PUBMED: 8524312. RA Sinha S., Kim I.-S., Sohn K.-Y., Crombrugghe B., Maity S. N. RT Three classes of mutations in the A subunit of the CCAAT-binding factor CBF delineate functional domains involved in the three-step assembly of the CBF-DNA complex RL Mol. Cell. Biol. 16:328-337 (1996). RN [4]; RE0017971. RX PUBMED: 9662544. RA Edwards D., Murray J. A., Smith A. G. RT Multiple genes encoding the conserved CCAAT-box transcription factor complex are expressed in Arabidopsis. RL Plant Physiol. 117:1015-1022 (1998). RN [5]; RE0047781. RX PUBMED: 12697811. RA Zika E., Greer S. F., Zhu X. S., Ting J. P. RT Histone deacetylase 1/mSin3A disrupts gamma interferon-induced CIITA function and major histocompatibility complex class II enhanceosome formation. RL Mol. Cell. Biol. 23:3091-3102 (2003). XX //