TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09019 XX ID T09019 XX DT 07.06.2006 (created); jag. DT 11.12.2008 (updated); spi. CO Copyright (C), QIAGEN. XX FA Mad3 XX SY 4631412E13Rik; MAD3; Max dimerization protein 3; MXD3. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G014366 Mxd3. XX CL C0012; bHLH-ZIP; 1.2.6.7.2.1. XX SZ 206 AA; 23.7 kDa (cDNA) (calc.). XX SQ MEPVASNIQVLLQAAEFLERREREAEHGYASLCPHHSPGTVCRRRKPPLQAPGALNSGRS SQ VHNELEKRRRAQLKRCLEQLRQQMPLGVDCTRYTTLSLLRRARVHIQKLEEQEQQARRLK SQ EKLRSKQQSLQQQLEQLQGLPGARERERLRADSLDSSGLSSERSDSDQEDLEVDVENLVF SQ GTETELLQSFSAGREHSYSHSTCAWL XX SC SPTREMBL #Q60947 XX FT 9 25 Sin3-interacting domain (SID) [1]. FT 43 110 PS50888; HLH. FT 58 110 PF00010; Helix-loop-helix DNA-binding domain. FT 59 70 basic region [1]. FT 63 115 SM00353; finulus. FT 71 108 helix-loop-helix domain [1]. FT 109 137 leucine zipper (LAL3) [1]. XX FF expression represses transcription especially in combination with Max [1]; FF antagonize transcriptional activities of c-Myc [1]; XX IN T05056 Max; human, Homo sapiens. IN T09085 Max; Mammalia. XX DR TRANSPATH: MO000082622. DR EMBL: U32394; DR UniProtKB: Q80US8; XX RN [1]; RE0006786. RX PUBMED: 8521822. RA Hurlin P. J., Queva C., Koskinen P. J., Steingrimsson E., Ayer D. E., Copeland N. G., Jenkins N. A., Eisenman R. N. RT Mad3 and Mad4: novel Max-interacting transcriptional repressors that suppress c-myc dependent transformation and are expressed during neural and epidermal differentiation RL EMBO J. 14:5646-5659 (1995). RN [2]; RE0050488. RX PUBMED: 15121849. RA Grinberg A. V., Hu C. D., Kerppola T. K. RT Visualization of Myc/Max/Mad family dimers and the competition for dimerization in living cells. RL Mol. Cell. Biol. 24:4294-4308 (2004). XX //