TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09033 XX ID T09033 XX DT 08.06.2006 (created); jag. DT 16.09.2014 (updated); hna. CO Copyright (C), QIAGEN. XX FA TEF-1 XX SY GT-IIC; MCBF; Sph factor; TEF1; transcriptional enhancer factor 1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004668 TEAD1; HGNC: TEAD1. XX CL C0024; TEA. XX SZ 426 AA; 47.9 kDa (cDNA) (calc.), 53 kDa (SDS) [2] [2] XX SQ MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIIL SQ SDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKDQTAKDKALQ SQ HMAAMSSAQIVSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAY SQ PIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFV SQ HIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD SQ DAGAFYGVTSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFVYRINRSPMCE SQ YMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHI SQ YRLVKD XX SC Swiss-Prot#P28347 XX FT 2 418 PF01285; TEA/ATTS domain family. FT 26 97 SM00426; TEA. FT 30 97 PS51088; TEA_2. FT 65 420 PF00478; IMP dehydrogenase / GMP reductase domain. FT 167 426 trans-activating region [3]. XX IN T01567 Max-isoform1; human, Homo sapiens. IN T25795 TAZ-isoform1; mouse, Mus musculus. XX MX M00704 V$TEF1_Q6. MX M01817 V$TEF1_Q6_03. MX M07340 V$TEF1_Q6_04. XX BS R31422. BS R31423. BS R31424. BS R31425. BS R31426. BS R29458. BS R31389. BS R21285. BS R21550. BS R63964. BS R21291. BS R21292. BS R21296. BS R26432. BS R09232. BS R21290. BS R26314. BS R01403. BS R01417. XX DR TRANSPATH: MO000082679. DR UniProtKB: P28347; XX RN [1]; RE0000071. RX PUBMED: 2986843. RA Emerson B. M., Lewis C. D., Felsenfeld G. RT Interaction of specific nuclear factors with the nuclease-hypersensitive region of the chicken adult beta-globin gene: nature of the binding domain RL Cell 41:21-30 (1985). RN [2]; RE0000125. RX PUBMED: 2843293. RA Davidson I., Xiao J. H., Rosales R., Staub A., Chambon P. RT The HeLa cell protein TEF-1 binds specifically and cooperatively to two SV40 enhancer motifs of unrelated sequence RL Cell 54:931-942 (1988). RN [3]; RE0000183. RX PUBMED: 1851669. RA Xiao J. H., Davidson I., Matthes H., Garnier J.-M., Chambon P. RT Cloning, expression, and transcriptional properties of the human enhancer factor TEF-1 RL Cell 65:551-568 (1991). RN [4]; RE0000256. RX PUBMED: 2070413. RA Buerglin T. R. RT The TEA domain: a novel, highly conserved DNA-binding motif RL Cell 66:11-12 (1991). RN [5]; RE0000368. RX PUBMED: 2826126. RA Xiao J. H., Davidson I., Ferrandon D., Rosales R., Vigneron M., Macchi M., Ruffenach F., Chambon P. RT One cell-specific and three ubiquitous proteins bind in vitro to overlapping motifs in the domain B1 of the SV40 enhancer RL EMBO J. 6:3005-3013 (1987). RN [6]; RE0000404. RX PUBMED: 2548845. RA Mercurio F., Karin M. RT Transcription factors AP-3 and AP-2 interact with the SV40 enhancer in a mutually exclusive manner RL EMBO J. 8:1455-1460 (1989). RN [7]; RE0001261. RX PUBMED: 3600658. RA Kemper B., Jackson P. D., Felsenfeld G. RT Protein-Binding Sites within the 5' DNase I-Hypersensitive Region of the Chicken alphaD-Globin Gene RL Mol. Cell. Biol. 7:2059-2069 (1987). RN [8]; RE0005291. RX PUBMED: 8389695. RA Hwang J.-J., Chambon P., Davidson I. RT Characterization of the transcription activation function and the DNA binding domain of transcriptional enhancer factor-1 RL EMBO J. 12:2337-2348 (1993). RN [9]; RE0005292. RX PUBMED: 7958896. RA Chen Z., Friedrich G. A., Soriano P. RT Transcriptional enhancer factor 1 disruption by a retroviral gene trap leads to heart defects and embryonic lethality in mice RL Genes Dev. 8:2293-2301 (1994). RN [10]; RE0005293. RX PUBMED: 8035807. RA Chaudhary S., Brou C., Valentin M.-E., Burton N., Tora L., Chambon P., Davidson I. RT A cell-specific factor represses stimulation of transcription in vitro by transcriptional enhancer factor 1 RL Mol. Cell. Biol. 14:5290-5299 (1994). RN [11]; RE0005294. RX PUBMED: 8441689. RA Blatt C., DePamphilis M. L. RT Striking homology between the mouse and human transcriptional enhancer factor-1 (TEF-1) RL Nucleic Acids Res. 21:747-748 (1993). RN [12]; RE0005295. RX PUBMED: 8106348. RA Stewart A. F., Larkin S. B., Farrance I. K., Mar J. H., Hall D. E., Ordahl C. P. RT Muscle-enriched TEF-1 isoforms bind M-CAT elements from muscle-specific promoters and differentially activate transcription RL J. Biol. Chem. 269:3147-3150 (1994). RN [13]; RE0047848. RX PUBMED: 10931933. RA Gupta M. P., Kogut P., Gupta M. RT Protein kinase-A dependent phosphorylation of transcription enhancer factor-1 represses its DNA-binding activity but enhances its gene activation ability. RL Nucleic Acids Res. 28:3168-3177 (2000). XX //