AC T09175
XX
ID T09175
XX
DT 02.08.2006 (created); jag.
CO Copyright (C), QIAGEN.
XX
FA Smad1-isoform1
XX
SY Madr1; SMAD-1.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G002393 SMAD1; HGNC: SMAD1.
XX
CL C0041; SMAD.
XX
SZ 465 AA; 52.3 kDa (cDNA) (calc.), 52.2 (kDa)
XX
SQ MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ
SQ PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV
SQ CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN
SQ SHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQ
SQ PMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
SQ DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
SQ NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW
SQ GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
XX
SC translated from EMBL #U59912
XX
FT 5 145 
MH1 domain [3].
FT 12 136 
PS51075; MH1.
FT 25 134 
SM00523; dwAneu5.
FT 27 131 
PF03165; MH1 domain.
FT 31 430 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 39 43 
Nuclear Localization Signal (NLS) [8].
FT 146 270 
Linker region [3].
FT 265 443 
PF03166; MH2 domain.
FT 269 441 
SM00524; DWB.
FT 271 461 
MH2 domain [3].
FT 271 461 MH2 domain [6].
FT 271 465 PS51076; MH2.
FT 462 465 SSXS motif [6].
XX
IN T14258 Nkx3-2; chick, Gallus gallus.
IN T34370 RN3; human, Homo sapiens.
XX
MX M01590 V$SMAD1_01.
MX M03845 V$SMAD1_Q6.
MX M08897 V$SMAD_Q4.
MX M00792 V$SMAD_Q6.
MX M00974 V$SMAD_Q6_01.
XX
BS R29688.
BS R10070.
XX
DR TRANSPATH: MO000084118.
DR EMBL: U59912; HSU59912.
DR UniProtKB: Q15797; Q15797.
XX
RN [1]; RE0015116.
RX PUBMED: 8673135.
RA Riggins G.J., Thiagalingam S., Rozenblum E., Weinstein C.L., Kern S.E., Hamilton S.R., Willson J.K., Markowitz S.D., Kinzler K.W., Vogelstein B.
RT Mad-related genes in the human
RL Nat. Genet. 13:347-349 (1996).
RN [2]; RE0015117.
RX PUBMED: 8637600.
RA Liu F., Hata A., Baker J.C., Doody J., Carcamo J., Harland R.M., Massague J.
RT A human Mad protein acting as a BMP-regulated transcriptional activator
RL Nature 381:620-623 (1996).
RN [3]; RE0015118.
RX PUBMED: 8653785.
RA Hoodless P.A., Haerry T., Abdollah S., Stapleton M., O'Connor M.B., Attisano L., Wrana J.L.
RT MADR1, a MAD-related protein that functions in BMP2 signaling pathways
RL Cell 85:489-500 (1996).
RN [4]; RE0015119.
RX PUBMED: 8663601.
RA Lechleider R. J., de Caestecker M. P., Dehejia A., Polymeropoulos M. H., Roberts A. B.
RT Serine phosphorylation, chromosomal localization, and transforming growth factor-beta signal transduction by human bsp-1
RL J. Biol. Chem. 271:17617-17620 (1996).
RN [5]; RE0015704.
RX PUBMED: 8653784.
RA Graff J. M., Bansal A., Melton D. A.
RT Xenopus Mad proteins transduce distinct subsets of signals for the TGF beta superfamily
RL Cell 85:479-487 (1996).
RN [6]; RE0015705.
RX PUBMED: 8752209.
RA Eppert K., Scherer S. W., Ozcelik H., Pirone R., Hoodless P., Kim H., Tsui L. C., Bapat B., Gallinger S., Andrulis I. L., Thomsen G. H., Wrana J. L., Attisano L.
RT MADR2 maps to 18q21 and encodes a TGFbeta-regulated MAD-related protein that is functionally mutated in colorectal carcinoma.
RL Cell 86:543-552 (1996).
RN [7]; RE0016084.
RX PUBMED: 10329393.
RA Xu R. H., Lechleider R. J., Shih H. M., Hao C. F., Sredni D., Roberts A. B., Kung H. F.
RT Functional analysis of human Smad1: role of the amino-terminal domain.
RL Biochem. Biophys. Res. Commun. 258:366-373 (1999).
RN [8]; RE0016203.
RX PUBMED: 10884415.
RA Xiao Z., Liu X., Henis Y. I., Lodish H. F.
RT A distinct nuclear localization signal in the N terminus of Smad 3 determines its ligand-induced nuclear translocation.
RL Proc. Natl. Acad. Sci. USA 97:7853-7858 (2000).
RN [9]; RE0016458.
RX PUBMED: 9006934.
RA Nakao A., Roijer E., Imamura T., Souchelnytskyi S., Stenman G., Heldin C. H., ten Dijke P.
RT Identification of Smad2, a human Mad-related protein in the transforming growth factor beta signaling pathway
RL J. Biol. Chem. 272:2896-2900 (1997).
RN [10]; RE0020652.
RX PUBMED: 11509558.
RA Xiao Z., Watson N., Rodriguez C., Lodish H. F.
RT Nucleocytoplasmic shuttling of smad1 conferred by its nuclear localization and nuclear export signals
RL J. Biol. Chem. 276:39404-39410 (2001).
RN [11]; RE0031346.
RX PUBMED: 12650946.
RA Warner D. R., Pisano M. M., Roberts E. A., Greene R. M.
RT Identification of three novel Smad binding proteins involved in cell polarity.
RL FEBS Lett. 539:167-73 (2003).
RN [12]; RE0032276.
RX PUBMED: 14612411.
RA Kim D. W., Lassar A. B.
RT Smad-dependent recruitment of a histone deacetylase/Sin3A complex modulates the bone morphogenetic protein-dependent transcriptional repressor activity of Nkx3.2.
RL Mol. Cell. Biol. 23:8704-17 (2003).
RN [13]; RE0048068.
RX PUBMED: 15464984.
RA Warner D. R., Bhattacherjee V., Yin X., Singh S., Mukhopadhyay P., Pisano M. M., Greene R. M.
RT Functional interaction between Smad, CREB binding protein, and p68 RNA helicase.
RL Biochem. Biophys. Res. Commun. 324:70-76 (2004).
RN [14]; RE0048069.
RX PUBMED: 14559231.
RA Ellis L. R., Warner D. R., Greene R. M., Pisano M. M.
RT Interaction of Smads with collagen types I, III, and V.
RL Biochem. Biophys. Res. Commun. 310:1117-1123 (2003).
XX
//