TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09236 XX ID T09236 XX DT 16.08.2006 (created); din. DT 10.06.2015 (updated); jmh. CO Copyright (C), QIAGEN. XX FA Cdx-2 XX SY caudal homolog homeobox protein 2; caudal type homeo box 2; Cdx-2; CDX2. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G001230 Cdx2. XX CL C0006; homeo. XX SZ 311 AA; 33.5 kDa (gene) (calc.), 37 kDa (SDS) [3] XX SQ MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAATANLDSAQS SQ PGPSWPTAYGAPLREDWNGYAPGGAAAANAVAHGLNGGSPAAAMGYSSPAEYHAHHHPHH SQ HPHHPAASPSCASGLLQTLNLGPPGPAATAAAEQLSPSGQRRNLCEWMRKPAQQSLGSQV SQ KTRTKDKYRVVYTDHQRLELEKEFHFSRYITIRRKSELAATLGLSERQVKIWFQNRRAKE SQ RKIKKKQQQQQQQQQQQPPQPPPQPSQPQPGALRSVPEPLSPVTSLQGSVPGSVPGVLGP SQ AGGVLNSTVTQ XX SC Swiss-Prot#P43241 XX FT 13 179 PF04731; Caudal like protein activation region. FT 15 180 activation domain [6]. FT 183 243 PS50071; HOMEOBOX_2. FT 185 247 SM00389; HOX_1. FT 186 242 PF00046; Homeobox domain. XX IN T00759 Sp1; human, Homo sapiens. XX MX M01449 V$CDX2_01. MX M00729 V$CDX2_Q5. MX M01659 V$CDX2_Q5_01. MX M02087 V$CDX2_Q5_02. MX M07416 V$CDX2_Q6. MX M07378 V$CDX_Q4. MX M00991 V$CDX_Q5. XX BS R26172. BS R14712. BS R28996. BS R28997. BS R28998. BS R28999. BS R29000. BS R04239. BS R41285. BS R08858. BS R08859. BS R68202. BS R68204. BS R68205. BS R68207. BS R68209. BS R68210. BS R08873. XX DR TRANSPATH: MO000085124. DR TRANSCOMPEL: C00583. DR EMBL: U00454; DR UniProtKB: P43241; XX RN [1]; RE0005015. RX PUBMED: 1671571. RA James R. J., Kazenwadel J. RT Homeobox gene expression in the intetnal epithelium of adult mice RL J. Biol. Chem. 266:3246-3251 (1991). RN [2]; RE0005016. RX PUBMED: 7910823. RA James R. J., Erler T., Kazenwadel J. RT Structure of the murine homeobox gene cdx-2. Expression in embryonic and adult intestine epithelium RL J. Biol. Chem. 269:15229-15237 (1994). RN [3]; RE0005017. RX PUBMED: 7935448. RA Suh E., Chen L., Taylor J., Traber P. G. RT A homeodomain protein related to caudal regulates intestine-specific gene transcription RL Mol. Cell. Biol. 14:7340-7351 (1994). RN [4]; RE0011831. RX PUBMED: 8524295. RA Jin T., Drucker D. J. RT Activation of proglucagon gene transcription through a novel promoter element by the caudal-related homeodomain protein cdx-2/3 RL Mol. Cell. Biol. 16:19-28 (1996). RN [5]; RE0014381. RX PUBMED: 8552090. RA Suh E., Traber P. G. RT An intestine-specific homeobox gene regulates proliferation and differentiation RL Mol. Cell. Biol. 16:619-625 (1996). RN [6]; RE0014389. RX PUBMED: 9171078. RA Taylor J. K., Levy T., Suh E. R., Traber P. G. RT Activation of enhancer elements by the homeobox gene Cdx2 is cell line specific RL Nucleic Acids Res. 25:2293-2300 (1997). RN [7]; RE0014407. RX PUBMED: 9428790. RA Taylor J. K., Boll W., Levy T., Suh E., Siang S., Mantei N., Traber P. G. RT Comparison of intestinal phospholipase A/lysophospholipase and sucrase-isomaltase genes suggest a common structure for enterocyte-specific promoters RL DNA Cell Biol. 16:1419-1428 (1997). RN [8]; RE0052368. RX PUBMED: 16616718. RA Shimakura J., Terada T., Shimada Y., Katsura T., Inui K. RT The transcription factor Cdx2 regulates the intestine-specific expression of human peptide transporter 1 through functional interaction with Sp1. RL Biochem. Pharmacol. 71:1581-1588 (2006). XX //