TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09275 XX ID T09275 XX DT 30.08.2006 (created); sri. DT 07.04.2015 (updated); pro. CO Copyright (C), QIAGEN. XX FA PUR1 XX SY CAGER-1; PUR-alpha; pura; purine-rich single- stranded DNA-binding protein alpha; ssCRE-BP; transcriptional activator protein pur-alpha. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004539 Pura. XX CL C0015; HMG. XX SZ 321 AA; 34.9 kDa (calc.). XX SQ MADRDSGSEQGGAALGSGGSLGHPGSGSGSGGGGGGGGGGGGSGGGGGAPGGLQHETQEL SQ ASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHY SQ AQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLG SQ STQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTSLTVDNKRFFFDVGSNKYG SQ VFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQEKQREKRAACEQLHQQQQQ SQ QQEETTAATLLLQGEEEGEED XX SC translated from EMBL #U02098 XX FT 31 48 glycine-rich region (17/18) [3]. FT 51 300 PF00478; IMP dehydrogenase / GMP reductase domain. FT 57 277 PF04845; PurA ssDNA and RNA-binding protein. FT 59 121 SM00712; PUR. FT 65 88 acid class I repeat (probably part of DNA-binding domain) [3]. FT 106 130 acid class II repeat (probably part of DNA-binding domain) [3]. FT 141 209 SM00712; PUR. FT 147 169 acid class I repeat (probably part of DNA-binding domain) [3]. FT 194 219 acid class II repeat (probably part of DNA-binding domain) [3]. FT 217 278 SM00712; PUR. FT 223 245 acid class I repeat (probably part of DNA-binding domain) [3]. FT 250 277 alpha helical region [3]. FT 296 302 glutamine-rich region (7/7) [3]. XX IN T05172 PUR-beta; mouse, Mus musculus. IN T01124 TEF-1; mouse, Mus musculus. IN T02496 YB-1; mouse, Mus musculus. XX MX M01721 V$PUR1_Q4. XX BS R67022. BS R26857. BS R57271. BS R12761. BS R26185. XX DR TRANSPATH: MO000085934. DR EMBL: AF017631; DR EMBL: U02098; DR UniProtKB: P42669; XX RN [1]; RE0011395. RX PUBMED: 7592647. RA Johnson E. M., Chen P.-L., Krackmarov C. P., Barr S. M., Kanovsky M., Ma Z.-W., Lee W.-H. RT Association of human Puralpha with the retinoblastoma protein, Rb, regulates binding to the single-stranded DNA Puralpha recognition element RL J. Biol. Chem. 270:24352-24360 (1995). RN [2]; RE0017923. RX PUBMED: 7959008. RA Ma Z. W., Bergemann A. D., Johnson E. M. RT Conservation in human and mouse Pur alpha of a motif common to several proteins involved in initiation of DNA replication RL Gene 149:311-314 (1994). RN [3]; RE0017924. RX PUBMED: 9334258. RA Kelm RJ J. r., Elder P. K., Strauch A. R., Getz M. J. RT Sequence of cDNAs encoding components of vascular actin single-stranded DNA-binding factor 2 establish identity to Puralpha and Purbeta RL J. Biol. Chem. 272:26727-26733 (1997). RN [4]; RE0017925. RX PUBMED: 11751932. RA Carlini L. E., Getz M. J., Strauch A. R., Kelm RJ J. r. RT Cryptic MCAT enhancer regulation in fibroblasts and smooth muscle cells. Suppression of TEF-1 mediated activation by the single-stranded DNA-binding proteins, Pur alpha, Pur beta, and MSY1 RL J. Biol. Chem. 277:8682-8692 (2002). RN [5]; RE0017928. RX PUBMED: 7739527. RA Sun S., Stoflet E. S., Cogan J. G., Strauch A. R., Getz M. J. RT Negative regulation of the vascular smooth muscle alpha-actin gene in fibroblasts and myoblasts: disruption of enhancer function by sequence-specific single-stranded-DNA-binding proteins. RL Mol. Cell. Biol. 15:2429-2436 (1995). XX //