AC T09638
XX
ID T09638
XX
DT 08.11.2006 (created); sou.
DT 12.12.2006 (updated); kau.
CO Copyright (C), QIAGEN.
XX
FA Hand2
XX
SY dHand; heart- and neural crest derivatives-expressed 2; Hed; Th2; Thing2.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G005386 Hand2.
XX
CL C0010; bHLH.
XX
SZ 217 AA; 24.3 kDa (cDNA) (calc.).
XX
SQ MSLVGGFPHHPVVHHEGYPLRRSRHHRFHHHHQPLHPRGEPLLHGWLIGHPEMSPPDYSM
SQ ALSYSPEYASGAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFA
SQ ELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEK
SQ RKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
XX
SC translated from EMBL #U40039
XX
FT 99 152 
PS50888; HLH.
FT 100 152 
PF00010; Helix-loop-helix DNA-binding domain.
FT 105 157 
SM00353; finulus.
XX
IN T17415 E12; Mammalia.
IN T10541 E2A; mouse, Mus musculus.
IN T04370 Hand2; mouse, Mus musculus.
XX
DR TRANSPATH: MO000090923.
DR EMBL: U40039;
DR UniProtKB: Q61039;
XX
RN [1]; RE0006047.
RX PUBMED: 9192865.
RA Biben C., Harvey R. P.
RT Homeodomain factor Nkx2-5 controls left/right asymmetric expression of bHLH gene eHand during murine heart development
RL Genes Dev. 11:1357-1369 (1997).
RN [2]; RE0006279.
RX PUBMED: 8533092.
RA Srivastava D., Cserjesi P., Olson E. N.
RT A subclass of bHLH proteins required for cardiac morphogenesis
RL Science 270:1995-1999 (1995).
RN [3]; RE0015952.
RX PUBMED: 7671815.
RA Cross J. C., Flannery M. L., Blanar M. A., Steingrimsson E., Jenkins N. A., Copeland N. G., Rutter W. J., Werb Z.
RT Hxt encodes a basic helix-loop-helix transcription factor that regulates trophoblast cell development
RL Development 121:2513-2523 (1995).
RN [4]; RE0015953.
RX PUBMED: 9171826.
RA Srivastava D., Thomas T., Lin Q., Kirby M. L., Brown D., Olson E. N.
RT Regulation of cardiac mesodermal and neural crest development by the bHLH transcription factor, dHAND
RL Nat. Genet. 16:154-160 (1997).
RN [5]; RE0015954.
RX PUBMED: 9671575.
RA Thomas T., Kurihara H., Yamagishi H., Kurihara Y., Yazaki Y., Olson E. N., Srivastava D.
RT A signaling cascade involving endothelin-1, dHAND and Msx1 regulates development of neural-crest-derived branchial arch mesenchyme
RL Development 125:3005-3014 (1998).
RN [6]; RE0015956.
RX PUBMED: 9576835.
RA Thomas T., Yamagishi H., Overbeek P. A., Olson E. N., Srivastava D.
RT The bHLH factors, dHAND and eHAND, specify pulmonary and systemic cardiac ventricles independent of left-right sidedness
RL Dev. Biol. 196:228-236 (1998).
RN [7]; RE0015961.
RX PUBMED: 10024240.
RA Yamagishi H., Garg V., Matsuoka R., Thomas T., Srivastava D.
RT A molecular pathway revealing a genetic basis for human cardiac and craniofacial defects
RL Science 283:1158-1161 (1999).
RN [8]; RE0015975.
RX PUBMED: 10675351.
RA Yamagishi H., Olson E. N., Srivastava D.
RT The basic helix-loop-helix transcription factor, dHAND, is required for vascular development.
RL J. Clin. Invest. 105:261-270 (2000).
RN [9]; RE0015976.
RX PUBMED: 10769237.
RA Fernandez-Teran M., Piedra M. E., Kathiriya I. S., Srivastava D., Rodriguez-Rey J. C., Ros M. A.
RT Role of dHAND in the anterior-posterior polarization of the limb bud: implications for the Sonic hedgehog pathway
RL Development 127:2133-2142 (2000).
RN [10]; RE0048975.
RX PUBMED: 11812799.
RA Dai Y. S., Cserjesi P.
RT The basic helix-loop-helix factor, HAND2, functions as a transcriptional activator by binding to E-boxes as a heterodimer.
RL J. Biol. Chem. 277:12604-12612 (2002).
XX
//