TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T10108 XX ID T10108 XX DT 10.01.2007 (created); sts. CO Copyright (C), QIAGEN. XX FA NURR1-isoform1 XX SY NOT; NR4A2; Nur-related factor 1; Nurr1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002229 NR4A2; HGNC: NR4A2. XX CL C0002; CC (rec). XX SZ 598 AA; 66.6 kDa (cDNA) (calc.). XX SQ MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF SQ STFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSV SQ YYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQ SQ SPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHA SQ SQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL SQ ANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSP SQ PVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGW SQ AEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFG SQ EWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVT SQ FNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF XX SC Swiss-Prot#P43354 XX FT 26 406 PF00478; IMP dehydrogenase / GMP reductase domai. FT 260 331 SM00399; c4gold. FT 260 335 PS51030; NUCLEAR_REC_DBD_2. FT 261 336 PF00105; Zinc finger, C4 type (two domains). FT 408 566 SM00430; holi. FT 411 591 PF00104; Ligand-binding domain of nuclear hormon. FT 583 596 AF-2 (activation function 2) core region [4]. XX FF induces maturation of both murine MM13 and human H9 embryonic stem cell to the midbrain dopamine neuron phenotype in co-ordination with Pitx3 T04311 [8]; XX IN T17209 ERK2; Mammalia. XX MX M02273 V$NR4A2_01. MX M01269 V$NURR1_Q3. MX M07427 V$NURR1_Q3_01. XX BS R58986. BS R58987. BS R58988. XX DR TRANSPATH: MO000095970. DR EMBL: X75918; DR UniProtKB: P43354; XX RN [1]; RE0013625. RX PUBMED: 10219237. RA Nuclear Receptors Nomenclature Committee. RT A unified nomenclature system for the nuclear receptor superfamily RL Cell 97:161-163 (1999). RN [2]; RE0013631. RX PUBMED: 7877627. RA Mages H. W., Rilke O., Bravo R., Senger G., Kroczek R. A. RT NOT, a human immediate-early response gene closely related to the steroid/thyroid hormone receptor NAK1/TR3 RL Mol. Endocrinol. 8:1583-1591 (1994). RN [3]; RE0016856. RX PUBMED: 11121187. RA Buervenich S., Carmine A., Arvidsson M., Xiang F., Zhang Z., Sydow O., Jonsson E. G., Sedvall G. C., Leonard S., Ross R. G., Freedman R., Chowdari K. V., Nimgaonkar V. L., Perlmann T., Anvret M., Olson L. RT NURR1 mutations in cases of schizophrenia and manic-depressive disorder RL Am. J. Med. Genet. 96:808-813 (2000). RN [4]; RE0016859. RX PUBMED: 10601324. RA Castro D. S., Arvidsson M., Bondesson Bolin M., Perlmann T. RT Activity of the Nurr1 carboxyl-terminal domain depends on cell type and integrity of the activation function 2 RL J. Biol. Chem. 274:37483-37490 (1999). RN [5]; RE0016863. RX PUBMED: 11159837. RA Tetradis S., Bezouglaia O., Tsingotjidou A. RT Parathyroid hormone induces expression of the nuclear orphan receptor Nurr1 in bone cells RL Endocrinology 142:663-670 (2001). RN [6]; RE0016872. RX PUBMED: 9070291. RA Maruyama K., Tsukada T., Bandoh S., Sasaki K., Ohkura N., Yamaguchi K. RT Retinoic acids differentially regulate NOR-1 and its closely related orphan nuclear receptor genes in breast cancer cell line MCF-7 RL Biochem. Biophys. Res. Commun. 231:417-420 (1997). RN [7]; RE0051501. RX PUBMED: 17681692. RA Zhang T., Jia N., Fei E., Wang P., Liao Z., Ding L., Yan M., Nukina N., Zhou J., Wang G. RT Nurr1 is phosphorylated by ERK2 in vitro and its phosphorylation upregulates tyrosine hydroxylase expression in SH-SY5Y cells. RL Neurosci. Lett. 423:118-122 (2007). RN [8]; RE0051892. RX PUBMED: 16477036. RA Martinat C., Bacci J. J., Leete T., Kim J., Vanti W. B., Newman A. H., Cha J. H., Gether U., Wang H., Abeliovich A. RT Cooperative transcription activation by Nurr1 and Pitx3 induces embryonic stem cell maturation to the midbrain dopamine neuron phenotype. RL Proc. Natl. Acad. Sci. USA 103:2874-2879 (2006). XX //