TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T10215 XX ID T10215 XX DT 02.02.2007 (created); sou. DT 13.11.2009 (updated); spi. CO Copyright (C), QIAGEN. XX FA TTF-1 XX SY Homeobox protein Nkx-2.1; Nkx-2.1; Nkx2.1; T/EBP; thyroid nuclear factor 1; TTF-1. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004905 Nkx2-1. XX CL C0053; NK-2/Nkx; 3.1.2.14.1.1. XX SZ 372 AA; 38.6 kDa (cDNA) (calc.). XX SQ MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPAAAMQQHAVGH SQ HGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDP SQ RFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRF SQ KQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGG SQ GGAGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQSHAQQQAQQQAQAAQA SQ AAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAGLQGQVSSLSHLNSSGSDYGA SQ MSCSTLLYGRTW XX SC Swiss-Prot#P50220 XX FT 159 219 PS50071; HOMEOBOX_2. FT 161 223 SM00389; HOX_1. FT 162 218 PF00046; Homeobox domain. FT 255 271 NK-2 domain [6]. XX IN T10208 GATA-6-isoform1; mouse, Mus musculus. XX MX M01312 V$NKX21_01. MX M00432 V$TITF1_Q3. MX M02034 V$TTF1_Q5. MX M03891 V$TTF1_Q5_01. MX M00794 V$TTF1_Q6. XX BS R04657. BS R13152. BS R13154. BS R13155. BS R13142. BS R13143. BS R13231. BS R13249. BS R13250. BS R13251. XX DR TRANSPATH: MO000098127. DR EMBL: U19755; DR UniProtKB: P50220; XX RN [1]; RE0000467. RX PUBMED: 1976511. RA Guazzi S., Price M., de Felice M., Damante G., Mattei M., Di Lauro R. RT Thyroid nuclear factor 1 (TTF-1) contains a homeodomain and displays a novel DNA binding specificity RL EMBO J. 9:3631-3639 (1990). RN [2]; RE0000696. RX PUBMED: 1989905. RA Avvedimento V. E., Musti A. M., Ueffing M., Obici S., Gallo A., Sanchez M., DeBrasi D., Gottesman M. E. RT Reversible inhibition of a thyroid-specific trans-acting factor by Ras RL Genes Dev. 5:22-28 (1991). RN [3]; RE0001499. RX PUBMED: 1922026. RA Mizuno K., Gonzales F. J., Kimura S. RT Thyroid-specific enhancer-binding protein (T/EBP): cDNA cloning, functional characterization, and structural identity with thyroid transcription factor TTF-1 RL Mol. Cell. Biol. 11:4927-4993 (1991). RN [4]; RE0006697. RX PUBMED: 9226442. RA Shimamura K., Rubenstein J. L. R. RT Inductive interactions direct early regionalization of the mouse forebrain RL Development 124:2709-2718 (1997). RN [5]; RE0006700. RX PUBMED: 7774016. RA Ericson J., Muhr J., Placzek M., Lints T., Jessell T. M., Edlund T. RT Sonic hedgehog induces the differentiation of ventral forebrain neurons: a common signal for ventral patterning within the neural tube RL Cell 81:747-756 (1995). RN [6]; RE0015674. RX PUBMED: 9533954. RA Qiu M., Shimamura K., Sussel L., Chen S., Rubenstein J. L. RT Control of anteroposterior and dorsoventral domains of Nkx-6.1 gene expression relative to other Nkx genes during vertebrate CNS development RL Mech. Dev. 72:77-88 (1998). RN [7]; RE0022227. RX PUBMED: 11914369. RA Weidenfeld J., Shu W., Zhang L., Millar S. E., Morrisey E. E. RT The WNT7b promoter is regulated by TTF-1, GATA6, and Foxa2 in lung epithelium. RL J. Biol. Chem. 277:21061-21070 (2002). RN [8]; RE0025027. RX PUBMED: 9584181. RA Sepulveda J. L., Belaguli N., Nigam V., Chen C. Y., Nemer M., Schwartz R. J. RT GATA-4 and Nkx-2.5 coactivate Nkx-2 DNA binding targets: role for regulating early cardiac gene expression. RL Mol. Cell. Biol. 18:3405-3415 (1998). XX //