TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T10385 XX ID T10385 XX DT 12.04.2007 (created); din. DT 02.04.2008 (updated); dbh. CO Copyright (C), QIAGEN. XX FA Hey1-isoform1 XX SY cardiovascular helix-loop-helix factor 2; CHF2; hairy and enhancer of split related-1; Herp2; hes-related repressor protein 2 herp2; hesr-1; hesr1; hey1; HRT1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004059 HEY1; HGNC: HEY1. XX CL C0010; bHLH. XX SZ 304 AA; 32.6 kDa (calc.). XX SQ MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR SQ RRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAM SQ DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPW SQ GTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV SQ LPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTE SQ IGAF XX SC translated from EMBL #AJ272214 XX FT 2 294 PF00478; IMP dehydrogenase / GMP reductase domain. FT 50 62 basic region [1]. FT 50 104 basic helix-loop-helix domain [1]. FT 50 105 PS50888; HLH. FT 52 105 PF00010; Helix-loop-helix DNA-binding domain. FT 55 110 SM00353; finulus. FT 62 104 helix-loop-helix motif [1]. FT 120 167 SM00511; ORANGE. FT 121 165 orange domain [1]. FT 121 167 PF07527; Hairy Orange. FT 122 158 PS51054; ORANGE. FT 294 297 YRPW motif [5]. FT 299 304 conserved motif TE(I/V)GAF [1]. XX IN T01346 arnt-isoform1; human, Homo sapiens. XX BS R12364. XX DR TRANSPATH: MO000104350. DR EMBL: AJ272214; DR UniProtKB: Q9Y5J3; XX RN [1]; RE0017655. RX PUBMED: 10588864. RA Nakagawa O., Nakagawa M., Richardson J. A., Olson E. N., Srivastava D. RT HRT1, HRT2, and HRT3: a new subclass of bHLH transcription factors marking specific cardiac, somitic, and pharyngeal arch segments. RL Dev. Biol. 216:72-84 (1999). RN [2]; RE0017656. RX PUBMED: 10860664. RA Steidl C., Leimeister C., Klamt B., Maier M., Nanda I., Dixon M., Clarke R., Schmid M., Gessler M. RT Characterization of the human and mouse HEY1, HEY2, and HEYL genes: cloning, mapping, and mutation screening of a new bHLH gene family RL Genomics 66:195-203 (2000). RN [3]; RE0017657. RX PUBMED: 10964718. RA Maier M. M., Gessler M. RT Comparative analysis of the human and mouse Hey1 promoter: Hey genes are new Notch target genes RL Biochem. Biophys. Res. Commun. 275:652-660 (2000). RN [4]; RE0017667. RX PUBMED: 11095750. RA Nakagawa O., McFadden D. G., Nakagawa M., Yanagisawa H., Hu T., Srivastava D., Olson E. N. RT Members of the HRT family of basic helix-loop-helix proteins act as transcriptional repressors downstream of Notch signaling. RL Proc. Natl. Acad. Sci. USA 97:13655-13660 (2000). RN [5]; RE0017201. RX PUBMED: 10692439. RA Chin M. T., Maemura K., Fukumoto S., Jain M. K., Layne M. D., Watanabe M., Hsieh C. M., Lee M. E. RT Cardiovascular basic helix loop helix factor 1, a novel transcriptional repressor expressed preferentially in the developing and adult cardiovascular system RL J. Biol. Chem. 275:6381-6387 (2000). XX //