TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T10946 XX ID T10946 XX DT 20.10.2007 (created); bch. DT 20.11.2007 (updated); bch. CO Copyright (C), QIAGEN. XX FA LXR-beta XX SY LXR B; LXR-B; LXRB; NER; NR1H2; nuclear orphan receptor LXR-beta; orphan nuclear receptor OR-1; oxysterol receptor LXR-beta; ubiquitously expressed nuclear receptor; UR. XX OS rat, Rattus norvegicus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002741 Nr1h2. XX CL C0002; CC (rec). XX SZ 446 AA; 49.8 kDa (cDNA) (calc.). XX SQ MSSPTSSLDTPLPGNGSPQPSTSSTSPTIKEEVQETDPPPGSEGSSSAYIVVILEPEDEP SQ ERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSG SQ TCQMDAFMRRKCQLCRLRKCKEAGMREQCVLSEEQIRKKKIQKQQQQQPPPPTEPASGSS SQ ARPAASPGTSEASSQGSGEGEGIQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLG SQ ADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLE SQ TARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIA SQ INIFSADRPNVQEPSRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVH SQ SEQVFALRLQDKKLPPLLSEIWDVHE XX SC translated from EMBL #U20389 XX FT 1 77 aminoterminal domain with PEST sequence [2]. FT 75 148 SM00399; c4gold. FT 75 152 PS51030; NUCLEAR_REC_DBD_2. FT 76 153 PF00105; Zinc finger, C4 type (two domains). FT 146 446 putative ligand-binding domain [2]. FT 258 417 SM00430; holi. FT 261 441 PF00104; Ligand-binding domain of nuclear hormon. XX IN T08497 TIF2; human, Homo sapiens. XX MX M00965 V$DR4_Q2. MX M00647 V$LXR_Q3. MX M03795 V$LXR_Q6. MX M07280 V$NR1NR2_Q3. XX BS R09956. BS R09966. XX DR TRANSPATH: MO000115766. DR EMBL: U14533; DR EMBL: U20389; DR UniProtKB: Q62755; XX RN [1]; RE0001904. RX PUBMED: 2922054. RA Mader S., Kumar V., de Verneuil H., Chambon P. RT Three amino acids of the oestrogen receptor are essential to its ability to distinguish an oestrogen from a glucocorticoid-responsive element RL Nature 338:271-275 (1989). RN [2]; RE0010769. RX PUBMED: 7892230. RA Teboul M., Enmark E., Li Q., Wikstrom A. C., Pelto-Huikko M., Gustafsson J.-A. RT OR-1, a member of the nuclear receptor superfamily that interacts with the 9-cis-retinoic acid receptor RL Proc. Natl. Acad. Sci. USA 92:2096-2100 (1995). RN [3]; RE0016034. RX PUBMED: 7971966. RA Song C., Kokontis J. M., Hiipakka R. A., Liao S. RT Ubiquitous receptor: a receptor that modulates gene activation by retinoic acid and thyroid hormone receptors RL Proc. Natl. Acad. Sci. USA 91:10809-10813 (1994). RN [4]; RE0050921. RX PUBMED: 10936612. RA Song C., Hiipakka R. A., Liao S. RT Selective activation of liver X receptor alpha by 6alpha-hydroxy bile acids and analogs. RL Steroids 65:423-427 (2000). RN [5]; RE0051059. RX PUBMED: 11089551. RA Song C., Liao S. RT Cholestenoic acid is a naturally occurring ligand for liver X receptor alpha. RL Endocrinology 141:4180-4184 (2000). XX //