TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T11166 XX ID T11166 XX DT 15.11.2007 (created); ssr. DT 28.10.2014 (updated); jmh. CO Copyright (C), QIAGEN. XX FA FKHL5 XX SY Freac-1 (Forkhead RElated ACtivator-1); HFH-8; HNF-3/Fkh Homolog 8. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G013777 Foxf1. XX CL C0023; fork head. XX SZ 378 AA; 40.0 kDa (cDNA) (calc.). XX SQ MSAPDKQQPPHGGGTGGGGGAGGQAMDPAAAGPTKAKKTNAGVRRPEKPPYSYIALIVMA SQ IQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGH SQ YWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPVYSMVNGLGFNHLPDTYGFQGSGGLSC SQ APNSLALEGGLGMMNGHLAGNVDGMALPSHSVPHLPSNGGHSYMGGCGGSAAGEYPHHDS SQ SVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASAALNSGASYIKQQPLSPCNPAANPLS SQ GSISTHSLEQPYLHQNSHNGPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHTTGG SQ GSYYHQQVTYQDIKPCVM XX SC Swiss-Prot#Q61080 XX FT 21 111 SM00339; forkneu4. FT 23 117 PS50039; FORK_HEAD_3. FT 23 118 PF00250; Fork head domain. FT 32 44 conflict: GPTKAKKTNAGVR -> PHQGQEDQRRRA [2]. FT 48 147 fork head domain [1]. FT 232 272 conflict: AGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPA -> GRGVPAPRQLGARFTAARPAPAESWSRTPFTPALQQPG [2]. XX IN T25961 mkl1-isoform2; mouse, Mus musculus. IN T05970 myocardin-isoform1; mouse, Mus musculus. IN T16471 SRF; Mammalia. XX MX M03573 V$FKHL5_Q3. MX M00809 V$FOX_Q2. MX M00294 V$HFH8_01. XX BS R05060. BS R05063. BS R05061. BS R05059. BS R04656. BS R05064. XX DR TRANSPATH: MO000117656. DR EMBL: L35949; DR EMBL: U42556; DR UniProtKB: Q61080; XX RN [1]; RE0006655. RA TRANSFAC_Team. RT Revisions of transcription factor domains RL TRANSFAC Reports 1:0002 (1998). RN [2]; RE0006874. RX PUBMED: 7958446. RA Clevidence D. E., Overdier D. G., Peterson R. S., Porcella A., Ye H., Paulson K. E., Costa R. H. RT Members of the HNF-3/forkhead family of transcription factors exhibit distinct cellular expression patterns in lung and regulate the surfactant protein B promoter RL Dev. Biol. 116:195-209 (1994). RN [3]; RE0006877. RX PUBMED: 8626802. RA Hellqvist M., Mahlapuu M., Samuelsson L., Enerbaeck S., Carlsson P. RT Differential activation of lung-specific genes by two forkhead proteins, FREAC-1 and FREAC-2 RL J. Biol. Chem. 271:4482-4490 (1996). RN [4]; RE0006911. RX PUBMED: 9486531. RA Peterson R. S., Linn L., Ye H., Zhou H., Overdier D. G., Costa R. H. RT The winged helix transcriptional activator HFH-8 is expressed in the mesoderm of the primitive streak stage of mouse embryos and its cellular derivatives RL Mech. Dev. 69:53-69 (1997). RN [5]; RE0048271. RX PUBMED: 16439479. RA Ormestad M., Astorga J., Landgren H., Wang T., Johansson B. R., Miura N., Carlsson P. RT Foxf1 and Foxf2 control murine gut development by limiting mesenchymal Wnt signaling and promoting extracellular matrix production. RL Development 133:833-843 (2006). RN [6]; RE0048282. RX PUBMED: 12003781. RA Kalinichenko V. V., Zhou Y., Shin B., Stolz D. B., Watkins S. C., Whitsett J. A., Costa R. H. RT Wild-type levels of the mouse Forkhead Box f1 gene are essential for lung repair. RL Am. J. Physiol. Lung Cell. Mol. Physiol. 282:L1253-65 (2002). RN [7]; RE0048284. RX PUBMED: 11124112. RA Mahlapuu M., Ormestad M., Enerback S., Carlsson P. RT The forkhead transcription factor Foxf1 is required for differentiation of extra-embryonic and lateral plate mesoderm. RL Development 128:155-166 (2001). XX //