TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T14127 XX ID T14127 XX DT 01.01.1999 (created); ili. DT 11.08.2014 (updated); yre. CO Copyright (C), QIAGEN. XX FA SATB1-isoform1 XX SY special AT-rich sequence binding protein 1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002308 SATB1; HGNC: SATB1. XX HO murine SATB1-isoform1. XX CL C0006; homeo; 3.1.9.3.1.1. XX SZ 763 AA; 86.0 kDa (cDNA) (calc.), ca. 90 kDa (SDS) [2], 96-97 kDa (SDS) [5], 103 kDa (SDS) [1] [5] [1] [2] XX SQ MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHS SQ GHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGY SQ SHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLP SQ PEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWY SQ KHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPAQLSHGSQPSVRTPL SQ PNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHPPPVSRSMNKP SQ LEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ SQ SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLISTPPSRPPQVKTATIA SQ TERNGKPENNTMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDPSP SQ ENRTLWENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQQQQQQQQ SQ QQQQQQQAPPPPQPQQQPQTGPRLPPRQPTVASPAESDEENRQKTRPRTKISVEALGILQ SQ SFIQDVGLYPDEEAIQTLSAQLDLPKYTIIKFFQNQRYYLKHHGKLKDNSGLEVDVAEYK SQ EEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLKD XX SC Swiss-Prot#Q01826-1 XX FT 182 701 PF00478; IMP dehydrogenase / GMP reductase domain. FT 346 495 DNA-binding domain [1]. FT 361 448 PS51042; CUT. FT 362 448 PF02376; CUT domain. FT 370 445 similarity to Cut- and Clox-homeo-proteins of Drosophila and mammals [3]. FT 484 571 PF02376; CUT domain. FT 484 571 PS51042; CUT. FT 493 568 similarity to Cut- and Clox-homeo-proteins of Drosophila and mammals [3]. FT 593 607 Q-stretch [2]. FT 641 702 homeodomain-like domain [3]. FT 642 703 PS50071; HOMEOBOX_2. FT 642 704 PS50560; CUT_HOMEODOMAIN. FT 644 707 SM00389; HOX_1. FT 645 702 PF00046; Homeobox domain. XX SF phosphorylated [1]; SF binds as a monomer [1]; SF appears to be directed by its homeodomain-like domain toward a preferential recognition of the core unwinding element [3]; XX CP predominantly in thymus [2]; minute amounts in brain [2]; very low in testis [2]; HL60 [1] [6]; Jurkat [4]; K562 [5] [6]; U937, CEM, Namalwa, KG1, fetal liver, adult bone marrow [6] [5] [6] [1] [2] [4]. CN breast cancer cell line SK-BR-3 [4]; HeLa [6] [6] [4]. XX FF binds to minor groove with little contact to DNA bases [2]; FF does not bind to ssDNA [2]; FF contacts AT-rich sequences flanked by sequences in which 1 strand contains only C, A & T [2]; FF these AT-rich sequences must have unpairing properties [1]; FF a small quantity remains extractable after stabilization procedures [5]; FF caution: distribution changes according to the stabilizing treatment used during matrix preparation [5]; FF not affected by apoptosis in hematopoietic cell line, but proteolyzed in apoptotic thymocytes [7]; XX IN T04734 LUN-isoform1; human, Homo sapiens. IN T22884 SATB2; Mammalia. IN T16034 Sox-2; mouse, Mus musculus. XX MX M01723 V$SATB1_Q3. XX BS R32418. BS R23361. BS R23365. BS R23367. BS R03635. XX DR TRANSPATH: MO000056081. DR SMARTDB: SB000012. DR EMBL: M97287; HSSATB1A. DR UniProtKB: Q01826-1; XX RN [1]; RE0006986. RX PUBMED: 8114718. RA Nakagomi K., Kohwi Y., Dickinson L. A., Kohwi-Shigematsu T. RT A novel DNA-binding motif in the nuclear matrix attachment DNA-binding protein SATB1 RL Mol. Biol. Cell 14:1852-1860 (1994). RN [2]; RE0006988. RX PUBMED: 1505028. RA Dickinson L. A., Joh T., Kohwi Y., Kohwi-Shigematsu T. RT A tissue-specific MAR/SAR DNA-binding protein with unusual binding site recognition RL Cell 70:631-645 (1992). RN [3]; RE0007006. RX PUBMED: 9111059. RA Dickinson L. A., Dickinson C. D., Kohwi-Shigematsu T. RT An atypical homeodomain in SATB1 promotes specific recognition of the key structural element in a matrix attachment region RL J. Biol. Chem. 272:11463-11470 (1997). RN [4]; RE0007048. RX PUBMED: 9548713. RA deBelle I., Cai S., Kohwi-Shigematsu T. RT The genomic sequences bound to special AT-rich sequence-binding protein 1 (SATB1) in vivo in Jurkat T cells are tightly associated with the nuclear matrix at the bases of the chromatin loops RL J. Cell Biol. 141:335-348 (1998). RN [5]; RE0013347. RX PUBMED: 9215557. RA Neri L. M., Fackelmayer F. O., Zweyer M., Kohwi-Shigematsu T., Martelli A. M. RT Subnuclear localization of S/MAR-binding proteins is differently affected by in vitro stabilization with heat or Cu2+ RL Chromosoma 106:81-93 (1997). RN [6]; RE0013698. RX PUBMED: 8049444. RA Cunningham J. M., Purucker M. E., Jane S. M., Safer B., Vanin E. F., Ney P. A., Lowrey C. H., Nienhuis A. W. RT The regulatory element 3' to the gammaA-globin gene binds to the nuclear matrix and interacts with special A-T-rich binding protein (SATB1), an SAR/MAR-associating region DNA binding protein RL Blood 84:1298-1308 (1994). RN [7]; RE0017467. RX PUBMED: 10025665. RA Martelli A. M., Bortul R., Fackelmayer F. O., Tazzari P. L., Bareggi R., Narducci P., Zweyer M. RT Biochemical and morphological characterization of the nuclear matrix from apoptotic HL-60 cells RL J. Cell. Biochem. 72:35-46 (1999). RN [8]; RE0023899. RX PUBMED: 11937547. RA Kieffer L. J., Greally J. M., Landres I., Nag S., Nakajima Y., Kohwi-Shigematsu T., Kavathas P. B. RT Identification of a candidate regulatory region in the human CD8 gene complex by colocalization of DNase I hypersensitive sites and matrix attachment regions which bind SATB1 and GATA-3 RL J. Immunol. 168:3915-3922 (2002). RN [9]; RE0067926. RX PUBMED: 18408014. RA Tan J. A., Sun Y., Song J., Chen Y., Krontiris T. G., Durrin L. K. RT SUMO conjugation to the matrix attachment region-binding protein, special AT-rich sequence-binding protein-1 (SATB1), targets SATB1 to promyelocytic nuclear bodies where it undergoes caspase cleavage. RL J. Biol. Chem. 283:18124-18134 (2008). RN [10]; RE0070893. RX PUBMED: 20351170. RA Tan J. A., Song J., Chen Y., Durrin L. K. RT Phosphorylation-dependent interaction of SATB1 and PIAS1 directs SUMO-regulated caspase cleavage of SATB1. RL Mol. Cell. Biol. 30:2823-2836 (2010). XX //