TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00033 XX ID T00033 XX DT 25.01.1993 (created); hse. DT 31.07.2010 (updated); pch. CO Copyright (C), QIAGEN. XX FA AP-2alpha-isoform1 XX SY activator protein 2; AP-2 alpha; AP-2A; AP-2alpha. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004734 Tfap2a. XX CL C0032; bHSH; 1.3.1.0.1.1. XX SZ 437 AA; 48.0 kDa (cDNA) (calc.), 50 kDa (SDS) XX SQ MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPP SQ PYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSG SQ LDPRRDYRRHEDLLHGPHALGSGLGDLPIHSLPHAIEDVPHVEDPGINIPDQTVIKKGPV SQ SLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSP SQ PECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHL SQ ARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVARKNMLLATKQICKEFTDLLAQDRSPLG SQ NSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNS SQ HTDNSAKSSDKEEKHRK XX SC Swiss-Prot#P34056-1 XX FT 1 15 replaced by 1-9 in isoform 3, by 1-44 in isoform 4 [4]. FT 16 160 missing in isoform 2 [4]. FT 207 414 PF03299; Transcription factor AP-2. FT 390 390 missing in [1]. XX SF at least four splice variants differing in their N-termini [4]; XX CP expression in placenta and in embryo, neural crest cells and their derivatives [10]. EX Hypothalamus primordium,,,Theiler Stage 21; none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX brain,,,Theiler Stage 24; very high; RT-PCR; total RNA; [6]. EX brain,,,Theiler Stage 27; medium; RT-PCR; total RNA; [6]. EX brain,,,adult; none; RT-PCR; total RNA; [3]. EX brain,,,neonate (during the first month after birth); high; RT-PCR; total RNA; [6]. EX central canal,,,Theiler Stage 22; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX central canal,,,Theiler Stage 24; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX central nervous system,,,P0 (immediately after birth, postnatal development); detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX cerebellum,,,P0 (immediately after birth, postnatal development); detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX cerebellum,,,Theiler Stage 22; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX cerebellum,,,Theiler Stage 24; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX cerebral cortex,,,P0 (immediately after birth, postnatal development); none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX cerebral cortex,,,Theiler Stage 21; none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX cerebrum,,,adult; none; RT-PCR; total RNA; [3]. EX cornea,,,Theiler Stage 22; high; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX cornea,,,Theiler Stage 24; high; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX corpus striatum,,,P0 (immediately after birth, postnatal development); none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX cranial sensory ganglion,,,P0 (immediately after birth, postnatal development); none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX cranial sensory ganglion,,,Theiler Stage 21; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX dorsal root ganglion,,,Theiler Stage 22; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX dorsal root ganglion,,,Theiler Stage 24; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX ear,,,P0 (immediately after birth, postnatal development); none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX ear,,,Theiler Stage 21; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX epithelium of olfactory region of nasal cavity,,,P0 (immediately after birth, postnatal development); none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX epithelium of olfactory region of nasal cavity,,,Theiler Stage 21; none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX eye and related structures (right and left),,,Theiler Stage 22; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX eye and related structures (right and left),,,Theiler Stage 24; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX eye and related structures (right and left),,,adult; high; RT-PCR; total RNA; [3]. EX first pharyngeal pouch,,,Theiler Stage 22; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX first pharyngeal pouch,,,Theiler Stage 24; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX fourth ventricle,,,Theiler Stage 22; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX fourth ventricle,,,Theiler Stage 24; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX future corpus striatum,,,Theiler Stage 21; none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX grey substance of spinal cord,,,Theiler Stage 22; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX grey substance of spinal cord,,,Theiler Stage 24; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX hair follicle,,,Theiler Stage 22; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX hair follicle,,,Theiler Stage 24; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX heart,,,Theiler Stage 22; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX heart,,,Theiler Stage 24; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX heart,,,Theiler Stage 24; very low; RT-PCR; total RNA; [6]. EX heart,,,Theiler Stage 27; very low; RT-PCR; total RNA; [6]. EX heart,,,neonate (during the first month after birth); very low; RT-PCR; total RNA; [6]. EX hypothalamus,,,P0 (immediately after birth, postnatal development); none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX inferior ganglion of vagus,,,Theiler Stage 22; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX inferior ganglion of vagus,,,Theiler Stage 24; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX kidney (right and left),,,Theiler Stage 22; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX kidney (right and left),,,Theiler Stage 24; high; RT-PCR; total RNA; [6]. EX kidney (right and left),,,Theiler Stage 24; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX kidney (right and left),,,Theiler Stage 27; high; RT-PCR; total RNA; [6]. EX kidney (right and left),,,adult; medium; RT-PCR; total RNA; [3]. EX kidney (right and left),,,neonate (during the first month after birth); very high; RT-PCR; total RNA; [6]. EX large intestine,,,adult; none; RT-PCR; total RNA; [3]. EX liver,,,Theiler Stage 22; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX liver,,,Theiler Stage 24; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX liver,,,adult; none; RT-PCR; total RNA; [3]. EX lung,,,adult; none; RT-PCR; total RNA; [3]. EX mesencephalon,,,P0 (immediately after birth, postnatal development); detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX mesencephalon,,,Theiler Stage 21; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX mesencephalon,,,Theiler Stage 22; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX mesencephalon,,,Theiler Stage 24; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX mouse, Mus musculus,,,Theiler Stage 15; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [3]. EX mouse, Mus musculus,,,Theiler Stage 15; low; RT-PCR; RNA (undefined); [3]. EX mouse, Mus musculus,,,Theiler Stage 19; detectable; Northern blot; mRNA (poly-A); [3]. EX mouse, Mus musculus,,,Theiler Stage 19; very high; RT-PCR; RNA (undefined); [3]. EX mouse, Mus musculus,,,Theiler Stage 22; detectable; Northern blot; mRNA (poly-A); [3]. EX mouse, Mus musculus,,,Theiler Stage 22; very high; RT-PCR; RNA (undefined); [3]. EX mouse, Mus musculus,,,Theiler Stage 23; detectable; Northern blot; mRNA (poly-A); [3]. EX mouse, Mus musculus,,,Theiler Stage 23; very high; RT-PCR; RNA (undefined); [3]. EX mouse, Mus musculus,,,Theiler Stage 24; detectable; Northern blot; mRNA (poly-A); [3]. EX mouse, Mus musculus,,,Theiler Stage 24; very high; RT-PCR; RNA (undefined); [3]. EX mouse, Mus musculus,,,Theiler Stage 26; detectable; Northern blot; mRNA (poly-A); [3]. EX mouse, Mus musculus,,,Theiler Stage 26; very high; RT-PCR; RNA (undefined); [3]. EX mouse, Mus musculus,,,Theiler Stage 27; detectable; Northern blot; mRNA (poly-A); [3]. EX mouse, Mus musculus,,,Theiler Stage 27; very high; RT-PCR; RNA (undefined); [3]. EX muscles,,,adult; low; RT-PCR; total RNA; [3]. EX myelencephalon,,,Theiler Stage 22; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX myelencephalon,,,Theiler Stage 24; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX nasal cavity,,,Theiler Stage 22; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX nasal cavity,,,Theiler Stage 24; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX nephric vesicles,,,Theiler Stage 22; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX nephric vesicles,,,Theiler Stage 24; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX olfactory epithelium,,,Theiler Stage 22; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX olfactory epithelium,,,Theiler Stage 24; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX pons,,,Theiler Stage 22; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX pons,,,Theiler Stage 24; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX prevertebral ganglia,,,Theiler Stage 22; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX prevertebral ganglia,,,Theiler Stage 24; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX prosencephalon,,,Theiler Stage 22; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX prosencephalon,,,Theiler Stage 24; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX prostate gland,,,adult; medium; RT-PCR; total RNA; [3]. EX renal medulla,,,Theiler Stage 22; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX renal medulla,,,Theiler Stage 24; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX renal tubules,,,Theiler Stage 22; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX renal tubules,,,Theiler Stage 24; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX retina,,,P0 (immediately after birth, postnatal development); detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX retina,,,Theiler Stage 21; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX rhombencephalon,,,P0 (immediately after birth, postnatal development); detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX rhombencephalon,,,Theiler Stage 21; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX rhombencephalon,,,Theiler Stage 22; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX rhombencephalon,,,Theiler Stage 24; low; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX skin,,,Theiler Stage 22; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX skin,,,Theiler Stage 24; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX skin,,,adult; very high; RT-PCR; total RNA; [3]. EX small intestine,,,adult; none; RT-PCR; total RNA; [3]. EX spinal cord,,,P0 (immediately after birth, postnatal development); detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX spinal cord,,,Theiler Stage 21; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX spinal cord,,,Theiler Stage 22; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX spinal cord,,,Theiler Stage 24; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX spleen,,,Theiler Stage 22; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX spleen,,,Theiler Stage 24; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX spleen,,,adult; none; RT-PCR; total RNA; [3]. EX subventricular zone of the MGE (medial ganglionic eminence),,,P0 (immediately after birth, postnatal development); none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX subventricular zone of the MGE (medial ganglionic eminence),,,Theiler Stage 21; none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX sympathetic part of autonomic division of nervous system,,,Theiler Stage 22; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX sympathetic part of autonomic division of nervous system,,,Theiler Stage 24; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX thalamus,,,P0 (immediately after birth, postnatal development); detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX thalamus,,,Theiler Stage 21; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [9]. EX thymus,,,adult; medium; RT-PCR; total RNA; [3]. EX tongue,,,Theiler Stage 22; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX tongue,,,Theiler Stage 24; none; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX whisker pad,,,Theiler Stage 22; high; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. EX whisker pad,,,Theiler Stage 24; high; RNA-in situ hybridization (not further specified); RNA (undefined); [3]. XX FF may be involved in regulating development of PNS, face, limbs, skin, kidney [1]; FF for expression pattern in teeth, see [5]; FF moderate autoactivator of AP-2alpha-isoform1 [6]; FF both AP-2alpha-isoform1 and AP-2gamma T02470 can transactivate estrogen receptor alpha promoter which explains the correlation between AP-2 activity and estrogen receptor (ER) expression in breast cancer [7]; FF Ap-2delta T06431exhibited greater DNA sequence preference than did Ap-2alpha under in vitro conditions [8]; FF strong binding to site R16374; XX IN T02469 AP-2beta; mouse, Mus musculus. XX MX M00469 V$AP2ALPHA_01. MX M01045 V$AP2ALPHA_02. MX M01047 V$AP2ALPHA_03. MX M07348 V$AP2ALPHA_Q4. MX M01857 V$AP2ALPHA_Q6. MX M00800 V$AP2_Q3. MX M08867 V$AP2_Q4. MX M00189 V$AP2_Q6. MX M00915 V$AP2_Q6_01. MX M02819 V$TCFAP2A_03. XX BS R02121. BS R05065. BS R16375. BS R16374. BS R10745. BS R08502. BS R01054. XX DR TRANSPATH: MO000046020. DR EMBL: X57012; MMAP2. DR EMBL: X74216; MMTAAP2. DR UniProtKB: P34056-1; XX RN [1]; RE0000664. RX PUBMED: 1989904. RA Mitchell P. J., Timmons P. M., Hebert J. M., Rigby P. W., Tjian R. RT Transcription factor AP-2 is expressed in neural creast cell lineages during mouse embryogenesis RL Genes Dev. 5:105-119 (1991). RN [2]; RE0006796. RX PUBMED: 8233835. RA Moser M., Pscherer A., Bauer R., Imhof A., Seegers S., Kerscher M., Buettner R. RT The complete murine cDNA of the transcription factor AP-2 RL Nucleic Acids Res. 21:4844-4844 (1993). RN [3]; RE0006896. RX PUBMED: 7555706. RA Moser M., Imhof A., Pscherer A., Bauer R., Amselgruber W., Sinowatz F., Schule R., Buettner R. RT Cloning and characterization of a second AP-2 transcription factor: AP-2 beta RL Development 121:2779-2788 (1995). RN [4]; RE0006898. RX PUBMED: 7750631. RA Meier P., Koedood M., Philipp J., Fontana A., Mitchell P. J. RT Alternative mRNAs encode multiple isoforms of transcription factor AP-2 during murine embryogenesis RL Dev. Biol. 169:1-14 (1995). RN [5]; RE0014808. RA Pekkanen M., Nieminen P., Sahlberg C., Aberg T., Thesleff I. RT Gene expression in tooth (WWW database); URL: http://bite-it.helsinki.fi/AP2.htm RL Internet : (1996). RN [6]; RE0016804. RX PUBMED: 9858544. RA Imhof A., Schuierer M., Werner O., Moser M., Roth C., Bauer R., Buettner R. RT Transcriptional regulation of the AP-2alpha promoter by BTEB-1 and AP-2rep, a novel wt-1/egr-related zinc finger repressor RL Mol. Cell. Biol. 19:194-204 (1999). RN [7]; RE0016805. RX PUBMED: 10497269. RA McPherson L. A., Weigel R. J. RT AP2alpha and AP2gamma: a comparison of binding site specificity and trans-activation of the estrogen receptor promoter and single site promoter constructs RL Nucleic Acids Res. 27:4040-4049 (1999). RN [8]; RE0025452. RX PUBMED: 11522791. RA Zhao F., Satoda M., Licht J. D., Hayashizaki Y., Gelb B. D. RT Cloning and characterization of a novel mouse AP-2 transcription factor, AP-2delta, with unique DNA binding and transactivation properties. RL J. Biol. Chem. 276:40755-40760 (2001). RN [9]; RE0025447. RX PUBMED: 15618518. RA Gray P. A., Fu H., Luo P., Zhao Q., Yu J., Ferrari A., Tenzen T., Yuk D. I., Tsung E. F., Cai Z., Alberta J. A., Cheng L. P., Liu Y., Stenman J. M., Valerius M. T., Billings N., Kim H. A., Greenberg M. E., McMahon A. P., Rowitch D. H., Stiles C. D., Ma Q. RT Mouse brain organization revealed through direct genome-scale TF expression analysis. RL Science 306:2255-2257 (2004). RN [10]; RE0026934. RX PUBMED: 9765260. RA Shi D., Kellems R. E. RT Transcription factor AP-2gamma regulates murine adenosine deaminase gene expression during placental development. RL J. Biol. Chem. 273:27331-8 (1998). XX //