TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00325 XX ID T00325 XX DT 15.10.1992 (created); ewi. DT 10.10.2011 (updated); jig. CO Copyright (C), QIAGEN. XX FA Pit-1B XX SY GHF-1; growth hormone factor 1; Pit-1; Pit-1b; Pituitary-specific factor 1; pituitary-specific positive transcription factor 1; POU1F1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003928 POU1F1; HGNC: POU1F1. XX CL C0007; POU; 3.1.10.1.1.2. XX SZ 291 AA; 32.9 kDa (cDNA) (calc.). XX SQ MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHY SQ GNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEE SQ PIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSF SQ KNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPS SQ SQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR XX SC Swiss-Prot#P28069-1 XX FT 124 198 PF00157; Pou domain - N-terminal to homeobox domain. FT 124 198 SM00352; pou. FT 212 272 PS50071; HOMEOBOX_2. FT 212 274 PS50550; POU_HOMEODOMAIN. FT 214 276 SM00389; HOX_1. FT 215 271 PF00046; Homeobox domain. XX CP pituitary [6]. CN decidua, placenta [6]. XX FF activator, stimulating cells proliferation of somatotrophs, lactotrophs, and thyrotrophs [6]; FF naturally occurring A158P mutant within helix 1 of POU2 has lost gene activation capability, but still stimulates proliferation causing hypopituitarism in homozygous individuals [6]; FF R271W mutation (C-terminal border of POUh) leads to a DNA-binding dominant inhibitor affecting heterozygous individuals causing GH, Prl and TSH deficiency and, thus, mental and physical retardation (CPHD, Combined Pituitary Hormone Deficiency) [6] [7] [9]; XX IN T00112 c-Ets-1A; human, Homo sapiens. IN T08499 CBP; mouse, Mus musculus. IN T00325 Pit-1B; human, Homo sapiens. XX MX M01465 V$PIT1_01. MX M00802 V$PIT1_Q6. MX M03559 V$PIT1_Q6_01. MX M00744 V$POU1F1_Q6. XX BS R02160. BS R00611. BS R00612. BS R03100. XX DR TRANSPATH: MO000024854. DR TRANSCOMPEL: C00138. DR PATHODB: MT000002. DR PATHODB: MT000003. DR PATHODB: MT000004. DR PATHODB: MT000005. DR PATHODB: MT000006. DR PATHODB: MT000007. DR PATHODB: MT000008. DR PATHODB: MT000009. DR EMBL: D10216; DR EMBL: X62429; DR UniProtKB: P28069-1; XX RN [1]; RE0000072. RX PUBMED: 3594572. RA Bodner M., Karin M. RT A Pituitary-Specific Trans-Acting Factor Can Stimulate Transcription from the Growth Hormone Promoter in Extracts of Nonexpressing Cells RL Cell 50:267-275 (1987). RN [2]; RE0000073. RX PUBMED: 2902927. RA Bodner M., Castrillo J.-L., Theill L. E., Deerinck T., Ellisman M., Karin M. RT The Pituitary-Specific Transcription Factor GHF-1 Is a Homeobox-Containing Protein RL Cell 55:505-518 (1988). RN [3]; RE0000347. RX PUBMED: 3595566. RA Lefevre C., Imagawa M., Dana S., Grindlay J., Bodner M., Karin M. RT Tissue-specific expression of the human growth hormone gene is conferred in part by the binding of a specific trans-acting factor RL EMBO J. 6:971-981 (1987). RN [4]; RE0001249. RX PUBMED: 2903436. RA Hyman S. E., Comb M., Lin Y.-S., Pearlberg J., Green M. R., Goodman H. M. RT A Common trans-Acting Factor Is Involved in Transcriptional Regulation of Neurotransmitter Genes by Cyclic AMP RL Mol. Cell. Biol. 8:4225-4233 (1988). RN [5]; RE0002021. RX PUBMED: 2717408. RA Sharp Z. D., Helsel S., Cao Z., Barron E. A., Sanchez Y. RT DNA recognition element required for PUF-I mediated cell-type specific transcription of the rat prolactin gene RL Nucleic Acids Res. 17:2705-2722 (1989). RN [6]; RE0004433. RX PUBMED: 1509263. RA Pfaeffle R. W., DiMattia G. E., Parks J. S., Brown M. R., Wit J. M., Jansen M., van der Nat H., van den Brande J. L., Rosenfeld M. G., Ingraham H. A. RT Mutation of the POU-specific domain of Pit-1 and hypopituitarism without pituitary hypoplasia RL Science 257:1118-1121 (1992). RN [7]; RE0004434. RX PUBMED: 1509262. RA Radovick S., Nations M., Du Y., Berg L. A., Weintraub B. D., Wondisford F. E. RT A mutation in the POU-homeodomain of Pit-1 responsible for Combined Pituitary Hormone Deficiency RL Science 257:1115-1118 (1992). RN [8]; RE0004436. RX PUBMED: 8346040. RA Pernasetti F. M., Wera S., Belayew A., Martial J. A. RT Cloning of a human GHF-1/PIT-1 cDNA variant RL Nucleic Acids Res. 21:3584-3584 (1993). RN [9]; RE0004444. RX PUBMED: 1472057. RA Ohta K., Nobukuni Y., Mitsubuchi H., Fujimoto S., Matsuo N., Inagaki H., Endo F., Matsuda I. RT Mutations in the Pit-1 gene in children with combined pituitary hormone deficiency RL Biochem. Biophys. Res. Commun. 189:851-855 (1992). RN [10]; RE0047927. RX PUBMED: 12242337. RA Augustijn K. D., Duval D. L., Wechselberger R., Kaptein R., Gutierrez-Hartmann A., van der Vliet P. C. RT Structural characterization of the PIT-1/ETS-1 interaction: PIT-1 phosphorylation regulates PIT-1/ETS-1 binding. RL Proc. Natl. Acad. Sci. USA 99:12657-12662 (2002). RN [11]; RE0056145. RX PUBMED: 16263824. RA Cohen R. N., Brue T., Naik K., Houlihan C. A., Wondisford F. E., Radovick S. RT The role of CBP/p300 interactions and Pit-1 dimerization in the pathophysiological mechanism of combined pituitary hormone deficiency. RL J. Clin. Endocrinol. Metab. 91:239-247 (2006). XX //