TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00349 XX ID T00349 XX DT 15.10.1992 (created); ewi. DT 29.11.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Hap2p XX SY CBF-B (rat); CP1B (human, rat); HAP2; HAP2p; NF-YA. XX OS yeast, Saccharomyces cerevisiae OC Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. XX GE G004167 HAP2. XX HO hapB (Aspergillus nidulans) [5]. XX SZ 265 AA; 29.9 kDa (gene) (calc.). XX SQ MSADETDAKFHPLETDLQSDTAAATSTAAASRSPSLQEKPIEMPLDMGKAPSPRGEDQRV SQ TNEEDLFLFNRLRASQNRVMDSLEPQQQSQYTSSSVSTMEPSADFTSFSAVTTLPPPPHQ SQ QQQQQQQQQQQQQLVVQAQYTQNQPNLQSDVLGTAIAEQPFYVNAKQYYRILKRRYARAK SQ LEEKLRISRERKPYLHESRHKHAMRRPRGEGGRFLTAAEIKAMKSKKSGASDDPDDSHED SQ KKITTKIIQEQPHATSTAAAADKKT XX SC Swiss-Prot#P06774 XX FT 156 217 SM00521; CBF. FT 158 214 PF02045; CCAAT-binding transcription factor (CBF-B/N. XX SF glutamine-rich region; XX FF activator of components of the mitochondrial electron transport chain; FF modulates oleic acid response of COQ5, a C-methyltransferase involved in ubiquinone synthesis [7]; XX IN T01263 hap3; fission yeast, Schizosaccharomyces pombe. IN T00350 Hap3p; yeast, Saccharomyces cerevisiae. IN T00351 Hap4p; yeast, Saccharomyces cerevisiae. IN T00087 NF-YB; rat, Rattus norvegicus. IN T00154 NF-YB; human, Homo sapiens. IN T00616 NF-YB; mouse, Mus musculus. XX MX M00288 F$HAP234_01. XX BS R00989. BS R02869. BS R05058. BS R00262. BS R00263. BS R24727. BS R24729. XX DR EMBL: M15243; SCHAP2. DR UniProtKB: P06774; HAP2_YEAST. XX RN [1]; RE0000057. RX PUBMED: 2826015. RA Olesen J., Hahn S., Guarente L. RT Yeast HAP2 and HAP3 Activators Both Bind to the CYC1 Upstream Activation Site, UAS2, in an Interdependent Manner RL Cell 51:953-961 (1987). RN [2]; RE0000719. RX PUBMED: 2123465. RA Olesen J. T., Guarente L. RT The HAP2 subunit of yeast CCAAT transcriptional activator contains adjacent domains for subunit association and DNA recognition: model for the HAP2/3/4 complex RL Genes Dev. 4:1714-1729 (1990). RN [3]; RE0001357. RX PUBMED: 3547076. RA Pinkham J. L., Olesen J. T., Guarente L. P. RT Sequence and Nuclear Localization of the Saccharomyces cerevisiae HAP2 Protein, a Transcriptional Activator RL Mol. Cell. Biol. 7:578-585 (1987). RN [4]; RE0002678. RX PUBMED: 2832951. RA Hahn S., Guarente L. RT Yeast HAP2 and HAP3: transcriptional activators in a heteromeric complex RL Science 240:314-321 (1988). RN [5]; RE0015986. RX PUBMED: 9858535. RA Steidl S., Papagiannopoulos P., Litzka O., Andrianopoulos A., Davis M. A., Brakhage A. A., Hynes M. J. RT AnCF, the CCAAT binding complex of Aspergillus nidulans, contains products of the hapB, hapC, and hapE genes and is required for activation by the pathway-specific regulatory gene amdR. RL Mol. Cell. Biol. 19:99-106 (1999). RN [6]; RE0017971. RX PUBMED: 9662544. RA Edwards D., Murray J. A., Smith A. G. RT Multiple genes encoding the conserved CCAAT-box transcription factor complex are expressed in Arabidopsis. RL Plant Physiol. 117:1015-1022 (1998). RN [7]; RE0018184. RX PUBMED: 12393187. RA Hagerman R. A., Willis R. A. RT The yeast gene COQ5 is differentially regulated by Mig1p, Rtg3p and Hap2p. RL Biochim. Biophys. Acta 1578:51 (2002). XX //